Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 984589..985391 | Replicon | chromosome |
Accession | NZ_CP110611 | ||
Organism | Staphylococcus epidermidis strain CCSM0287 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | Q5HN83 |
Locus tag | OO001_RS04760 | Protein ID | WP_002468490.1 |
Coordinates | 985212..985391 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | Q5HN82 |
Locus tag | OO001_RS04755 | Protein ID | WP_002456349.1 |
Coordinates | 984589..985188 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO001_RS04730 | 979800..981257 | + | 1458 | WP_002440300.1 | ABC transporter substrate-binding protein/permease | - |
OO001_RS04735 | 981250..981972 | + | 723 | WP_002494439.1 | amino acid ABC transporter ATP-binding protein | - |
OO001_RS04740 | 982469..982624 | + | 156 | WP_001829854.1 | hypothetical protein | - |
OO001_RS04745 | 982834..983964 | + | 1131 | WP_001829814.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
OO001_RS04750 | 983961..984431 | + | 471 | WP_001829836.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
OO001_RS04755 | 984589..985188 | + | 600 | WP_002456349.1 | glucosamine-6-phosphate isomerase | Antitoxin |
OO001_RS04760 | 985212..985391 | + | 180 | WP_002468490.1 | SAS053 family protein | Toxin |
OO001_RS04765 | 985547..985951 | + | 405 | WP_001829818.1 | hypothetical protein | - |
OO001_RS04770 | 986136..987521 | + | 1386 | WP_001829862.1 | class II fumarate hydratase | - |
OO001_RS04775 | 987882..988706 | - | 825 | WP_001829804.1 | RluA family pseudouridine synthase | - |
OO001_RS04780 | 988865..989998 | + | 1134 | WP_001829819.1 | GAF domain-containing sensor histidine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | SCCmec | blaZ | groEL | 823919..994688 | 170769 | |
flank | IS/Tn | - | - | 982469..982624 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6963.56 Da Isoelectric Point: 4.3016
>T263961 WP_002468490.1 NZ_CP110611:985212-985391 [Staphylococcus epidermidis]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
Download Length: 180 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22709.62 Da Isoelectric Point: 4.9942
>AT263961 WP_002456349.1 NZ_CP110611:984589-985188 [Staphylococcus epidermidis]
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7HY44 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E9LUD0 |