Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-YefM
Location 3631881..3632383 Replicon chromosome
Accession NZ_CP110535
Organism Halomonas sp. BDJS001

Toxin (Protein)


Gene name yoeB Uniprot ID -
Locus tag OM794_RS16910 Protein ID WP_226247839.1
Coordinates 3632120..3632383 (+) Length 88 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag OM794_RS16905 Protein ID WP_226247837.1
Coordinates 3631881..3632123 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM794_RS16885 (OM794_16885) 3627019..3628377 + 1359 WP_226247829.1 NCS1 family transporter -
OM794_RS16890 (OM794_16890) 3628405..3629874 + 1470 WP_226247831.1 NCS1 family nucleobase:cation symporter-1 -
OM794_RS16895 (OM794_16895) 3630363..3630896 - 534 WP_226247833.1 hypothetical protein -
OM794_RS16900 (OM794_16900) 3631004..3631720 + 717 WP_226247835.1 hypothetical protein -
OM794_RS16905 (OM794_16905) 3631881..3632123 + 243 WP_226247837.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OM794_RS16910 (OM794_16910) 3632120..3632383 + 264 WP_226247839.1 Txe/YoeB family addiction module toxin Toxin
OM794_RS16915 (OM794_16915) 3632550..3632708 - 159 WP_226247841.1 ParD-like family protein -
OM794_RS16920 (OM794_16920) 3632851..3633183 + 333 WP_226247843.1 type II toxin-antitoxin system RelE/ParE family toxin -
OM794_RS16925 (OM794_16925) 3633185..3633472 + 288 WP_053856996.1 NadS family protein -
OM794_RS16930 (OM794_16930) 3633567..3633998 + 432 WP_226247845.1 acetyltransferase -
OM794_RS16935 (OM794_16935) 3634154..3634408 + 255 WP_226247847.1 type II toxin-antitoxin system ParD family antitoxin -
OM794_RS16940 (OM794_16940) 3634408..3634704 + 297 WP_226247849.1 type II toxin-antitoxin system RelE/ParE family toxin -
OM794_RS16945 (OM794_16945) 3634775..3636262 - 1488 WP_226247851.1 molybdate ABC transporter ATP-binding protein ModF -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(25-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10116.82 Da        Isoelectric Point: 10.2267

>T263956 WP_226247839.1 NZ_CP110535:3632120-3632383 [Halomonas sp. BDJS001]
VTWKLAYTKQAQKDAKKLVSSGLKPKAQELLALIAEDPYRKPPPFEKLIGDLAGAYSRRINIQHRLVYQVLEDERVVKVL
RLWSHYE

Download         Length: 264 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8929.99 Da        Isoelectric Point: 3.9085

>AT263956 WP_226247837.1 NZ_CP110535:3631881-3632123 [Halomonas sp. BDJS001]
MTGITATEARSNLYRLIDETAESHQPIVIMGKRNSAVLVSEEDWSAIQETLYLLSVPGMRESISEGMNTPVAECDEELDW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References