Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2962261..2962921 | Replicon | chromosome |
Accession | NZ_CP110533 | ||
Organism | Enterobacter quasiroggenkampii strain WS12-3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OM418_RS14040 | Protein ID | WP_048224499.1 |
Coordinates | 2962568..2962921 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1Z3MX79 |
Locus tag | OM418_RS14035 | Protein ID | WP_029741460.1 |
Coordinates | 2962261..2962563 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM418_RS14015 (OM418_14015) | 2958113..2960302 | + | 2190 | WP_045908133.1 | TonB-dependent siderophore receptor | - |
OM418_RS14025 (OM418_14025) | 2960735..2961124 | - | 390 | WP_277717817.1 | RidA family protein | - |
OM418_RS14030 (OM418_14030) | 2961266..2962186 | + | 921 | WP_277717818.1 | LysR family transcriptional regulator | - |
OM418_RS14035 (OM418_14035) | 2962261..2962563 | - | 303 | WP_029741460.1 | XRE family transcriptional regulator | Antitoxin |
OM418_RS14040 (OM418_14040) | 2962568..2962921 | - | 354 | WP_048224499.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OM418_RS14045 (OM418_14045) | 2963097..2963990 | - | 894 | WP_277717819.1 | LysR substrate-binding domain-containing protein | - |
OM418_RS14050 (OM418_14050) | 2964161..2964769 | + | 609 | WP_277717820.1 | glutathione S-transferase family protein | - |
OM418_RS14055 (OM418_14055) | 2964812..2965762 | - | 951 | WP_262778175.1 | HTH-type transcriptional regulator Cbl | - |
OM418_RS14060 (OM418_14060) | 2965859..2966776 | - | 918 | WP_045908128.1 | nitrogen assimilation transcriptional regulator NAC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13519.37 Da Isoelectric Point: 9.0310
>T263937 WP_048224499.1 NZ_CP110533:c2962921-2962568 [Enterobacter quasiroggenkampii]
VWAINTTDRFDRWFASLDDTDRASVLAALLVLREKGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
MLCAGNKVGNERRFYDEMLLVADREFTHWLNTLKERE
VWAINTTDRFDRWFASLDDTDRASVLAALLVLREKGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
MLCAGNKVGNERRFYDEMLLVADREFTHWLNTLKERE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|