Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 77439..78085 | Replicon | chromosome |
Accession | NZ_CP110533 | ||
Organism | Enterobacter quasiroggenkampii strain WS12-3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OM418_RS00350 | Protein ID | WP_277719131.1 |
Coordinates | 77735..78085 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1H8WUL1 |
Locus tag | OM418_RS00345 | Protein ID | WP_045352829.1 |
Coordinates | 77439..77738 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM418_RS00315 (OM418_00315) | 72839..73798 | - | 960 | WP_262802363.1 | DUF523 and DUF1722 domain-containing protein | - |
OM418_RS00320 (OM418_00320) | 73901..74314 | - | 414 | WP_048226512.1 | hydroxyisourate hydrolase | - |
OM418_RS00325 (OM418_00325) | 74414..75139 | - | 726 | WP_048030818.1 | MerR family transcriptional regulator | - |
OM418_RS00330 (OM418_00330) | 75257..75781 | + | 525 | WP_277718228.1 | lipocalin family protein | - |
OM418_RS00335 (OM418_00335) | 75860..76906 | + | 1047 | WP_277718229.1 | class I SAM-dependent methyltransferase | - |
OM418_RS00340 (OM418_00340) | 76972..77409 | + | 438 | WP_277718230.1 | acetyltransferase | - |
OM418_RS00345 (OM418_00345) | 77439..77738 | - | 300 | WP_045352829.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OM418_RS00350 (OM418_00350) | 77735..78085 | - | 351 | WP_277719131.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OM418_RS00355 (OM418_00355) | 78514..78855 | - | 342 | WP_277718231.1 | SymE family type I addiction module toxin | - |
OM418_RS00360 (OM418_00360) | 78939..79079 | + | 141 | WP_252077894.1 | hypothetical protein | - |
OM418_RS00365 (OM418_00365) | 79160..79972 | + | 813 | WP_252077893.1 | toll/interleukin-1 receptor domain-containing protein | - |
OM418_RS00375 (OM418_00375) | 80363..81754 | + | 1392 | WP_262752423.1 | glycoside-pentoside-hexuronide family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 66667..79972 | 13305 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13538.62 Da Isoelectric Point: 9.6740
>T263929 WP_277719131.1 NZ_CP110533:c78085-77735 [Enterobacter quasiroggenkampii]
MWTVRFGKVFEQWLFEQEEGLQDKVLADLLNLQHYGPRLPRPYADTVKGSRYKHMKKLRIQYAGRPVPTFFAFDPVRQAI
VLCAGDKSNDKTFYEKMIRIADAEFSLHLTSQEAAK
MWTVRFGKVFEQWLFEQEEGLQDKVLADLLNLQHYGPRLPRPYADTVKGSRYKHMKKLRIQYAGRPVPTFFAFDPVRQAI
VLCAGDKSNDKTFYEKMIRIADAEFSLHLTSQEAAK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|