Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 258..910 | Replicon | plasmid pRWS292.s5 |
| Accession | NZ_CP110528 | ||
| Organism | Klebsiella pneumoniae strain WS_29-2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B2CBE9 |
| Locus tag | OM422_RS30310 | Protein ID | WP_012457127.1 |
| Coordinates | 258..608 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | B2CBE8 |
| Locus tag | OM422_RS30315 | Protein ID | WP_012457126.1 |
| Coordinates | 611..910 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM422_RS30310 (OM422_30295) | 258..608 | + | 351 | WP_012457127.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OM422_RS30315 (OM422_30300) | 611..910 | + | 300 | WP_012457126.1 | helix-turn-helix domain-containing protein | Antitoxin |
| OM422_RS30320 (OM422_30305) | 972..1121 | - | 150 | WP_162262154.1 | hypothetical protein | - |
| OM422_RS30325 (OM422_30310) | 1284..1949 | - | 666 | WP_094309421.1 | hypothetical protein | - |
| OM422_RS30330 (OM422_30315) | 2334..3302 | + | 969 | WP_012457123.1 | zincin-like metallopeptidase domain-containing protein | - |
| OM422_RS30335 (OM422_30320) | 3486..4016 | - | 531 | WP_012457122.1 | phospholipase D family protein | - |
| OM422_RS30340 (OM422_30325) | 4119..4874 | - | 756 | WP_023316386.1 | MobC family replication-relaxation protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..41699 | 41699 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13378.26 Da Isoelectric Point: 6.7130
>T263918 WP_012457127.1 NZ_CP110528:258-608 [Klebsiella pneumoniae]
MWDIITTECFDGWFLAQSDALRESVYEAMGVLEKFGPALGRPYVDTLNDSDFANMKELRIQHHGNPVRAFFAFDPTRRAI
VLCAGDKTGANEKRFYKDMIRLADSEYRKHLAKLEK
MWDIITTECFDGWFLAQSDALRESVYEAMGVLEKFGPALGRPYVDTLNDSDFANMKELRIQHHGNPVRAFFAFDPTRRAI
VLCAGDKTGANEKRFYKDMIRLADSEYRKHLAKLEK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|