Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 93876..94533 Replicon plasmid pRWS292.s4
Accession NZ_CP110527
Organism Klebsiella pneumoniae strain WS_29-2

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag OM422_RS30270 Protein ID WP_000270043.1
Coordinates 94183..94533 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OM422_RS30265 Protein ID WP_000124640.1
Coordinates 93876..94178 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM422_RS30220 (OM422_30205) 89501..89929 + 429 WP_000591074.1 hypothetical protein -
OM422_RS30225 (OM422_30210) 89986..90345 + 360 WP_000422768.1 hypothetical protein -
OM422_RS30230 (OM422_30215) 90345..90791 + 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
OM422_RS30235 (OM422_30220) 90788..91306 + 519 WP_000210756.1 nitrite reductase -
OM422_RS30240 (OM422_30225) 91306..91536 + 231 WP_000972663.1 hypothetical protein -
OM422_RS30245 (OM422_30230) 91523..92380 + 858 WP_001167032.1 hypothetical protein -
OM422_RS30250 (OM422_30235) 92611..93138 + 528 WP_001236377.1 thermonuclease family protein -
OM422_RS30255 (OM422_30240) 93196..93468 + 273 WP_001043047.1 HU family DNA-binding protein -
OM422_RS30260 (OM422_30245) 93556..93849 + 294 WP_001239997.1 chromosome segregation protein ParM -
OM422_RS30265 (OM422_30250) 93876..94178 - 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
OM422_RS30270 (OM422_30255) 94183..94533 - 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OM422_RS30275 (OM422_30260) 94696..95244 + 549 WP_001061574.1 transcriptional regulator -
OM422_RS30280 (OM422_30265) 95585..95779 + 195 WP_000343597.1 hypothetical protein -
OM422_RS30285 (OM422_30270) 95790..96161 + 372 WP_000516916.1 hypothetical protein -
OM422_RS30290 (OM422_30275) 96154..96624 + 471 WP_001281821.1 hypothetical protein -
OM422_RS30295 (OM422_30280) 96639..96974 - 336 WP_000683476.1 hypothetical protein -
OM422_RS30300 (OM422_30285) 97071..97559 + 489 WP_001273096.1 DUF1643 domain-containing protein -
OM422_RS30305 (OM422_30290) 97562..98059 + 498 WP_000062185.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / blaNDM-1 - 1..98221 98221


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T263917 WP_000270043.1 NZ_CP110527:c94533-94183 [Klebsiella pneumoniae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT263917 WP_000124640.1 NZ_CP110527:c94178-93876 [Klebsiella pneumoniae]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References