Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 93876..94533 | Replicon | plasmid pRWS292.s4 |
| Accession | NZ_CP110527 | ||
| Organism | Klebsiella pneumoniae strain WS_29-2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U3PDC3 |
| Locus tag | OM422_RS30270 | Protein ID | WP_000270043.1 |
| Coordinates | 94183..94533 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OM422_RS30265 | Protein ID | WP_000124640.1 |
| Coordinates | 93876..94178 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM422_RS30220 (OM422_30205) | 89501..89929 | + | 429 | WP_000591074.1 | hypothetical protein | - |
| OM422_RS30225 (OM422_30210) | 89986..90345 | + | 360 | WP_000422768.1 | hypothetical protein | - |
| OM422_RS30230 (OM422_30215) | 90345..90791 | + | 447 | WP_000919345.1 | Fe3+-siderophore ABC transporter permease | - |
| OM422_RS30235 (OM422_30220) | 90788..91306 | + | 519 | WP_000210756.1 | nitrite reductase | - |
| OM422_RS30240 (OM422_30225) | 91306..91536 | + | 231 | WP_000972663.1 | hypothetical protein | - |
| OM422_RS30245 (OM422_30230) | 91523..92380 | + | 858 | WP_001167032.1 | hypothetical protein | - |
| OM422_RS30250 (OM422_30235) | 92611..93138 | + | 528 | WP_001236377.1 | thermonuclease family protein | - |
| OM422_RS30255 (OM422_30240) | 93196..93468 | + | 273 | WP_001043047.1 | HU family DNA-binding protein | - |
| OM422_RS30260 (OM422_30245) | 93556..93849 | + | 294 | WP_001239997.1 | chromosome segregation protein ParM | - |
| OM422_RS30265 (OM422_30250) | 93876..94178 | - | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
| OM422_RS30270 (OM422_30255) | 94183..94533 | - | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OM422_RS30275 (OM422_30260) | 94696..95244 | + | 549 | WP_001061574.1 | transcriptional regulator | - |
| OM422_RS30280 (OM422_30265) | 95585..95779 | + | 195 | WP_000343597.1 | hypothetical protein | - |
| OM422_RS30285 (OM422_30270) | 95790..96161 | + | 372 | WP_000516916.1 | hypothetical protein | - |
| OM422_RS30290 (OM422_30275) | 96154..96624 | + | 471 | WP_001281821.1 | hypothetical protein | - |
| OM422_RS30295 (OM422_30280) | 96639..96974 | - | 336 | WP_000683476.1 | hypothetical protein | - |
| OM422_RS30300 (OM422_30285) | 97071..97559 | + | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
| OM422_RS30305 (OM422_30290) | 97562..98059 | + | 498 | WP_000062185.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / blaNDM-1 | - | 1..98221 | 98221 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T263917 WP_000270043.1 NZ_CP110527:c94533-94183 [Klebsiella pneumoniae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|