Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 152316..153043 | Replicon | plasmid pRWS292.s1 |
| Accession | NZ_CP110524 | ||
| Organism | Klebsiella pneumoniae strain WS_29-2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | OM422_RS26180 | Protein ID | WP_011251285.1 |
| Coordinates | 152316..152627 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OM422_RS26185 | Protein ID | WP_011251286.1 |
| Coordinates | 152624..153043 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM422_RS26150 (OM422_26135) | 148033..149469 | + | 1437 | WP_052191568.1 | PLP-dependent aminotransferase family protein | - |
| OM422_RS26155 (OM422_26140) | 149631..149990 | - | 360 | Protein_162 | LysR substrate-binding domain-containing protein | - |
| OM422_RS26160 (OM422_26145) | 150197..150790 | - | 594 | Protein_163 | IS66 family transposase zinc-finger binding domain-containing protein | - |
| OM422_RS26165 (OM422_26150) | 150839..151186 | - | 348 | WP_094320106.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| OM422_RS26170 (OM422_26155) | 151183..151560 | - | 378 | WP_004118218.1 | transposase | - |
| OM422_RS26175 (OM422_26160) | 151674..152111 | + | 438 | Protein_166 | DDE-type integrase/transposase/recombinase | - |
| OM422_RS26180 (OM422_26165) | 152316..152627 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OM422_RS26185 (OM422_26170) | 152624..153043 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| OM422_RS26190 (OM422_26175) | 153190..153516 | + | 327 | Protein_169 | transposase | - |
| OM422_RS26195 (OM422_26180) | 153591..154075 | + | 485 | Protein_170 | transposase | - |
| OM422_RS26200 (OM422_26185) | 154161..155186 | + | 1026 | WP_001101446.1 | IS110 family transposase | - |
| OM422_RS26205 (OM422_26190) | 155481..156449 | + | 969 | WP_000654804.1 | IS5-like element IS903B family transposase | - |
| OM422_RS26210 (OM422_26195) | 156508..156906 | + | 399 | Protein_173 | integrase core domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..361091 | 361091 | |
| - | inside | IScluster/Tn | - | - | 142777..181663 | 38886 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T263909 WP_011251285.1 NZ_CP110524:152316-152627 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT263909 WP_011251286.1 NZ_CP110524:152624-153043 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|