Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 755307..756082 | Replicon | chromosome |
Accession | NZ_CP110523 | ||
Organism | Klebsiella pneumoniae strain WS_29-2 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1W1JAQ8 |
Locus tag | OM422_RS03795 | Protein ID | WP_009308645.1 |
Coordinates | 755597..756082 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | OM422_RS03790 | Protein ID | WP_004150912.1 |
Coordinates | 755307..755600 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM422_RS03770 (750515) | 750515..751117 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
OM422_RS03775 (751215) | 751215..752126 | + | 912 | WP_016947442.1 | LysR family transcriptional regulator | - |
OM422_RS03780 (752127) | 752127..753275 | - | 1149 | WP_016947441.1 | PLP-dependent aspartate aminotransferase family protein | - |
OM422_RS03785 (753286) | 753286..754662 | - | 1377 | WP_016947440.1 | cystathionine beta-synthase | - |
OM422_RS03790 (755307) | 755307..755600 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
OM422_RS03795 (755597) | 755597..756082 | + | 486 | WP_009308645.1 | GNAT family N-acetyltransferase | Toxin |
OM422_RS03800 (756786) | 756786..757379 | + | 594 | WP_004188553.1 | hypothetical protein | - |
OM422_RS03805 (757476) | 757476..757692 | + | 217 | Protein_747 | transposase | - |
OM422_RS03815 (758370) | 758370..759083 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 757476..757628 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17595.60 Da Isoelectric Point: 8.5144
>T263894 WP_009308645.1 NZ_CP110523:755597-756082 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1W1JAQ8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |