Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 21278..21930 | Replicon | plasmid pRWS291.s5 |
Accession | NZ_CP110519 | ||
Organism | Klebsiella pneumoniae strain WS_29-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | B2CBE9 |
Locus tag | OM421_RS30405 | Protein ID | WP_012457127.1 |
Coordinates | 21580..21930 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | B2CBE8 |
Locus tag | OM421_RS30400 | Protein ID | WP_012457126.1 |
Coordinates | 21278..21577 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM421_RS30375 (OM421_30370) | 17314..18069 | + | 756 | WP_023316386.1 | MobC family replication-relaxation protein | - |
OM421_RS30380 (OM421_30375) | 18172..18702 | + | 531 | WP_012457122.1 | phospholipase D family protein | - |
OM421_RS30385 (OM421_30380) | 18886..19854 | - | 969 | WP_012457123.1 | zincin-like metallopeptidase domain-containing protein | - |
OM421_RS30390 (OM421_30385) | 20239..20904 | + | 666 | WP_094309421.1 | hypothetical protein | - |
OM421_RS30395 (OM421_30390) | 21067..21216 | + | 150 | WP_162262154.1 | hypothetical protein | - |
OM421_RS30400 (OM421_30395) | 21278..21577 | - | 300 | WP_012457126.1 | helix-turn-helix domain-containing protein | Antitoxin |
OM421_RS30405 (OM421_30400) | 21580..21930 | - | 351 | WP_012457127.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OM421_RS30410 (OM421_30405) | 22324..22941 | + | 618 | WP_094309423.1 | ParA family protein | - |
OM421_RS30415 (OM421_30410) | 22996..23235 | + | 240 | WP_012457129.1 | plasmid partition protein ParG | - |
OM421_RS30420 (OM421_30415) | 23398..25020 | - | 1623 | WP_065813436.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
OM421_RS30425 (OM421_30420) | 25445..26149 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | - | 1..38030 | 38030 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13378.26 Da Isoelectric Point: 6.7130
>T263891 WP_012457127.1 NZ_CP110519:c21930-21580 [Klebsiella pneumoniae]
MWDIITTECFDGWFLAQSDALRESVYEAMGVLEKFGPALGRPYVDTLNDSDFANMKELRIQHHGNPVRAFFAFDPTRRAI
VLCAGDKTGANEKRFYKDMIRLADSEYRKHLAKLEK
MWDIITTECFDGWFLAQSDALRESVYEAMGVLEKFGPALGRPYVDTLNDSDFANMKELRIQHHGNPVRAFFAFDPTRRAI
VLCAGDKTGANEKRFYKDMIRLADSEYRKHLAKLEK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|