Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 375461..376107 | Replicon | chromosome |
Accession | NZ_CP110514 | ||
Organism | Klebsiella pneumoniae strain WS_29-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A486RBU5 |
Locus tag | OM421_RS01785 | Protein ID | WP_032410616.1 |
Coordinates | 375461..375808 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W8UB68 |
Locus tag | OM421_RS01790 | Protein ID | WP_002920557.1 |
Coordinates | 375808..376107 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM421_RS01775 (371387) | 371387..372820 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
OM421_RS01780 (372838) | 372838..375285 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
OM421_RS01785 (375461) | 375461..375808 | + | 348 | WP_032410616.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OM421_RS01790 (375808) | 375808..376107 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OM421_RS01795 (376170) | 376170..377678 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
OM421_RS01800 (377883) | 377883..378212 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
OM421_RS01805 (378263) | 378263..379093 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
OM421_RS01810 (379143) | 379143..379901 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13545.55 Da Isoelectric Point: 5.6802
>T263866 WP_032410616.1 NZ_CP110514:375461-375808 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATILILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFEPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATILILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFEPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A486RBU5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1CBF8 |