263865

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 349276..349862 Replicon chromosome
Accession NZ_CP110514
Organism Klebsiella pneumoniae strain WS_29-1

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag OM421_RS01675 Protein ID WP_032421870.1
Coordinates 349494..349862 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag OM421_RS01670 Protein ID WP_004174006.1
Coordinates 349276..349497 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM421_RS01650 (345433) 345433..346359 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OM421_RS01655 (346356) 346356..347633 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
OM421_RS01660 (347630) 347630..348397 + 768 WP_277696462.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OM421_RS01665 (348399) 348399..349112 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OM421_RS01670 (349276) 349276..349497 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OM421_RS01675 (349494) 349494..349862 + 369 WP_032421870.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OM421_RS01680 (350135) 350135..351451 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OM421_RS01685 (351558) 351558..352445 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OM421_RS01690 (352442) 352442..353287 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OM421_RS01695 (353289) 353289..354359 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 346356..355096 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13570.96 Da        Isoelectric Point: 8.6410

>T263865 WP_032421870.1 NZ_CP110514:349494-349862 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAMSRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT263865 WP_004174006.1 NZ_CP110514:349276-349497 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References