Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 349276..349862 | Replicon | chromosome |
Accession | NZ_CP110514 | ||
Organism | Klebsiella pneumoniae strain WS_29-1 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | OM421_RS01675 | Protein ID | WP_032421870.1 |
Coordinates | 349494..349862 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | W9B1V1 |
Locus tag | OM421_RS01670 | Protein ID | WP_004174006.1 |
Coordinates | 349276..349497 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM421_RS01650 (345433) | 345433..346359 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
OM421_RS01655 (346356) | 346356..347633 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
OM421_RS01660 (347630) | 347630..348397 | + | 768 | WP_277696462.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
OM421_RS01665 (348399) | 348399..349112 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
OM421_RS01670 (349276) | 349276..349497 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OM421_RS01675 (349494) | 349494..349862 | + | 369 | WP_032421870.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
OM421_RS01680 (350135) | 350135..351451 | + | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
OM421_RS01685 (351558) | 351558..352445 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
OM421_RS01690 (352442) | 352442..353287 | + | 846 | WP_004185988.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
OM421_RS01695 (353289) | 353289..354359 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 346356..355096 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13570.96 Da Isoelectric Point: 8.6410
>T263865 WP_032421870.1 NZ_CP110514:349494-349862 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAMSRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAMSRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|