Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 38100..38364 | Replicon | plasmid pRWS532 |
| Accession | NZ_CP110513 | ||
| Organism | Escherichia coli strain ws5-3 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | OM087_RS24075 | Protein ID | WP_001303307.1 |
| Coordinates | 38212..38364 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 38100..38157 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM087_RS24060 (33339) | 33339..35630 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
| OM087_RS24065 (35623) | 35623..36693 | - | 1071 | WP_000151580.1 | IncI1-type conjugal transfer protein TrbB | - |
| OM087_RS24070 (36712) | 36712..37920 | - | 1209 | WP_001303305.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (38100) | 38100..38157 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (38100) | 38100..38157 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (38100) | 38100..38157 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (38100) | 38100..38157 | - | 58 | NuclAT_0 | - | Antitoxin |
| OM087_RS24075 (38212) | 38212..38364 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| OM087_RS24080 (38436) | 38436..38687 | - | 252 | WP_001291967.1 | hypothetical protein | - |
| OM087_RS24085 (39186) | 39186..39281 | + | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
| OM087_RS24090 (39346) | 39346..39522 | - | 177 | WP_001054898.1 | hypothetical protein | - |
| OM087_RS24095 (39854) | 39854..40063 | + | 210 | WP_000062602.1 | HEAT repeat domain-containing protein | - |
| OM087_RS24100 (40135) | 40135..40797 | - | 663 | WP_160453039.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| OM087_RS24105 (40868) | 40868..43036 | - | 2169 | WP_257122961.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..83623 | 83623 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T263861 WP_001303307.1 NZ_CP110513:38212-38364 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT263861 NZ_CP110513:c38157-38100 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|