Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 38100..38364 Replicon plasmid pRWS532
Accession NZ_CP110513
Organism Escherichia coli strain ws5-3

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag OM087_RS24075 Protein ID WP_001303307.1
Coordinates 38212..38364 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 38100..38157 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM087_RS24060 (33339) 33339..35630 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
OM087_RS24065 (35623) 35623..36693 - 1071 WP_000151580.1 IncI1-type conjugal transfer protein TrbB -
OM087_RS24070 (36712) 36712..37920 - 1209 WP_001303305.1 IncI1-type conjugal transfer protein TrbA -
- (38100) 38100..38157 - 58 NuclAT_0 - Antitoxin
- (38100) 38100..38157 - 58 NuclAT_0 - Antitoxin
- (38100) 38100..38157 - 58 NuclAT_0 - Antitoxin
- (38100) 38100..38157 - 58 NuclAT_0 - Antitoxin
OM087_RS24075 (38212) 38212..38364 + 153 WP_001303307.1 Hok/Gef family protein Toxin
OM087_RS24080 (38436) 38436..38687 - 252 WP_001291967.1 hypothetical protein -
OM087_RS24085 (39186) 39186..39281 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
OM087_RS24090 (39346) 39346..39522 - 177 WP_001054898.1 hypothetical protein -
OM087_RS24095 (39854) 39854..40063 + 210 WP_000062602.1 HEAT repeat domain-containing protein -
OM087_RS24100 (40135) 40135..40797 - 663 WP_160453039.1 plasmid IncI1-type surface exclusion protein ExcA -
OM087_RS24105 (40868) 40868..43036 - 2169 WP_257122961.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..83623 83623


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T263861 WP_001303307.1 NZ_CP110513:38212-38364 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT263861 NZ_CP110513:c38157-38100 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References