Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 3778035..3778728 | Replicon | chromosome |
| Accession | NZ_CP110511 | ||
| Organism | Escherichia coli strain ws5-3 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | OM087_RS18180 | Protein ID | WP_000415584.1 |
| Coordinates | 3778035..3778331 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | - |
| Locus tag | OM087_RS18185 | Protein ID | WP_115723877.1 |
| Coordinates | 3778333..3778728 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM087_RS18145 (3773084) | 3773084..3773398 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
| OM087_RS18150 (3773429) | 3773429..3774010 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| OM087_RS18155 (3774368) | 3774368..3774700 | + | 333 | WP_115723875.1 | DUF2645 family protein | - |
| OM087_RS18160 (3774746) | 3774746..3776095 | - | 1350 | WP_115723876.1 | quorum sensing histidine kinase QseC | - |
| OM087_RS18165 (3776092) | 3776092..3776751 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| OM087_RS18170 (3776903) | 3776903..3777295 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| OM087_RS18175 (3777348) | 3777348..3777830 | + | 483 | WP_000183494.1 | GyrI-like domain-containing protein | - |
| OM087_RS18180 (3778035) | 3778035..3778331 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| OM087_RS18185 (3778333) | 3778333..3778728 | + | 396 | WP_115723877.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| OM087_RS18190 (3778860) | 3778860..3780467 | + | 1608 | Protein_3542 | ABC transporter substrate-binding protein | - |
| OM087_RS18195 (3780605) | 3780605..3782863 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3765681..3779084 | 13403 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T263854 WP_000415584.1 NZ_CP110511:3778035-3778331 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14717.13 Da Isoelectric Point: 9.2136
>AT263854 WP_115723877.1 NZ_CP110511:3778333-3778728 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGINAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGINAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|