Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3656606..3657405 | Replicon | chromosome |
Accession | NZ_CP110511 | ||
Organism | Escherichia coli strain ws5-3 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | OM087_RS17590 | Protein ID | WP_000347251.1 |
Coordinates | 3656606..3657070 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | OM087_RS17595 | Protein ID | WP_001307405.1 |
Coordinates | 3657070..3657405 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM087_RS17560 (3651607) | 3651607..3652041 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
OM087_RS17565 (3652059) | 3652059..3652937 | - | 879 | WP_001300474.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
OM087_RS17570 (3652927) | 3652927..3653706 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
OM087_RS17575 (3653717) | 3653717..3654190 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
OM087_RS17580 (3654213) | 3654213..3655493 | - | 1281 | WP_115723855.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
OM087_RS17585 (3655742) | 3655742..3656551 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
OM087_RS17590 (3656606) | 3656606..3657070 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
OM087_RS17595 (3657070) | 3657070..3657405 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
OM087_RS17600 (3657554) | 3657554..3659125 | - | 1572 | WP_032181387.1 | galactarate dehydratase | - |
OM087_RS17605 (3659500) | 3659500..3660834 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
OM087_RS17610 (3660850) | 3660850..3661620 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T263853 WP_000347251.1 NZ_CP110511:c3657070-3656606 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |