Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 2854096..2854698 | Replicon | chromosome |
| Accession | NZ_CP110511 | ||
| Organism | Escherichia coli strain ws5-3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | OM087_RS13660 | Protein ID | WP_000897305.1 |
| Coordinates | 2854387..2854698 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OM087_RS13655 | Protein ID | WP_000356397.1 |
| Coordinates | 2854096..2854386 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM087_RS13630 (2850041) | 2850041..2850943 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| OM087_RS13635 (2850940) | 2850940..2851575 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OM087_RS13640 (2851572) | 2851572..2852501 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| OM087_RS13645 (2852831) | 2852831..2853073 | - | 243 | WP_001086388.1 | protein YiiF | - |
| OM087_RS13650 (2853292) | 2853292..2853510 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| OM087_RS13655 (2854096) | 2854096..2854386 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| OM087_RS13660 (2854387) | 2854387..2854698 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| OM087_RS13665 (2854927) | 2854927..2855835 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| OM087_RS13670 (2855899) | 2855899..2856840 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| OM087_RS13675 (2856885) | 2856885..2857322 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| OM087_RS13680 (2857319) | 2857319..2858191 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| OM087_RS13685 (2858185) | 2858185..2858784 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| OM087_RS13690 (2858883) | 2858883..2859668 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T263851 WP_000897305.1 NZ_CP110511:c2854698-2854387 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|