Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3609147..3609792 | Replicon | chromosome |
Accession | NZ_CP110473 | ||
Organism | Pantoea anthophila strain CL1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A5M7PRL7 |
Locus tag | OJ965_RS19350 | Protein ID | WP_046101034.1 |
Coordinates | 3609439..3609792 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A855YNH6 |
Locus tag | OJ965_RS19345 | Protein ID | WP_009092569.1 |
Coordinates | 3609147..3609446 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OJ965_RS19330 (OJ965_19325) | 3605052..3606836 | - | 1785 | WP_046101035.1 | GMC family oxidoreductase | - |
OJ965_RS19335 (OJ965_19330) | 3606839..3607573 | - | 735 | WP_009092567.1 | gluconate 2-dehydrogenase subunit 3 family protein | - |
OJ965_RS19340 (OJ965_19335) | 3607850..3609091 | + | 1242 | WP_154928641.1 | peptide antibiotic transporter SbmA | - |
OJ965_RS19345 (OJ965_19340) | 3609147..3609446 | - | 300 | WP_009092569.1 | XRE family transcriptional regulator | Antitoxin |
OJ965_RS19350 (OJ965_19345) | 3609439..3609792 | - | 354 | WP_046101034.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OJ965_RS19355 (OJ965_19350) | 3609989..3611041 | - | 1053 | WP_265137512.1 | YncE family protein | - |
OJ965_RS19360 (OJ965_19355) | 3611241..3611450 | - | 210 | WP_009092571.1 | DUF1471 domain-containing protein | - |
OJ965_RS19365 (OJ965_19360) | 3611663..3612850 | - | 1188 | WP_265137513.1 | MFS transporter | - |
OJ965_RS19370 (OJ965_19365) | 3612955..3613932 | + | 978 | WP_009092573.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13570.43 Da Isoelectric Point: 5.2456
>T263838 WP_046101034.1 NZ_CP110473:c3609792-3609439 [Pantoea anthophila]
MWDIDTTHLFDEWFETQTEALKEDMLAAMIILSEYGPQLGRPYADTVDDSDFPNMKELRVQHQGNPIRAFFAFDPARRGI
VLCAGDKTGVKEKRFYKEMIKLADAEFRKHLKRGENG
MWDIDTTHLFDEWFETQTEALKEDMLAAMIILSEYGPQLGRPYADTVDDSDFPNMKELRVQHQGNPIRAFFAFDPARRGI
VLCAGDKTGVKEKRFYKEMIKLADAEFRKHLKRGENG
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5M7PRL7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A855YNH6 |