Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1669832..1670584 | Replicon | chromosome |
Accession | NZ_CP110473 | ||
Organism | Pantoea anthophila strain CL1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A506PAZ8 |
Locus tag | OJ965_RS10255 | Protein ID | WP_072052719.1 |
Coordinates | 1670249..1670584 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OJ965_RS10250 | Protein ID | WP_140028698.1 |
Coordinates | 1669832..1670164 (-) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OJ965_RS10225 (OJ965_10225) | 1664834..1665223 | + | 390 | WP_003849158.1 | chemotaxis response regulator CheY | - |
OJ965_RS10230 (OJ965_10230) | 1665233..1665874 | + | 642 | WP_009089682.1 | protein phosphatase CheZ | - |
OJ965_RS10235 (OJ965_10235) | 1666066..1667217 | + | 1152 | WP_046102008.1 | flagellar biosynthesis protein FlhB | - |
OJ965_RS10240 (OJ965_10240) | 1667210..1669309 | + | 2100 | WP_046102007.1 | flagellar biosynthesis protein FlhA | - |
OJ965_RS10245 (OJ965_10245) | 1669309..1669701 | + | 393 | WP_009089686.1 | flagellar protein FlhE | - |
OJ965_RS10250 (OJ965_10250) | 1669832..1670164 | - | 333 | WP_140028698.1 | HigA family addiction module antitoxin | Antitoxin |
OJ965_RS10255 (OJ965_10255) | 1670249..1670584 | - | 336 | WP_072052719.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OJ965_RS10260 (OJ965_10260) | 1670636..1671634 | - | 999 | WP_265139137.1 | aldo/keto reductase | - |
OJ965_RS10265 (OJ965_10265) | 1671870..1672787 | - | 918 | WP_265139138.1 | LysR substrate-binding domain-containing protein | - |
OJ965_RS10270 (OJ965_10270) | 1672871..1674601 | - | 1731 | WP_265139139.1 | arginine--tRNA ligase | - |
OJ965_RS10275 (OJ965_10275) | 1674813..1674935 | - | 123 | WP_009089698.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12919.78 Da Isoelectric Point: 9.7853
>T263835 WP_072052719.1 NZ_CP110473:c1670584-1670249 [Pantoea anthophila]
MIQGGHDVATLRNIDSFRDEWLRDFFLYGKHSGKIPMTLSSALARKLDIINAAVNYQDLRSPPGNRYEELNPPLKGYAAI
RVNEQYRLIFKWIDGKAVDLYLDPHSYKRHK
MIQGGHDVATLRNIDSFRDEWLRDFFLYGKHSGKIPMTLSSALARKLDIINAAVNYQDLRSPPGNRYEELNPPLKGYAAI
RVNEQYRLIFKWIDGKAVDLYLDPHSYKRHK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|