Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 24974..25632 | Replicon | plasmid pRBH2-5 |
| Accession | NZ_CP110467 | ||
| Organism | Acinetobacter baumannii strain RBH2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OMP06_RS20095 | Protein ID | WP_000312250.1 |
| Coordinates | 25273..25632 (-) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OMP06_RS20090 | Protein ID | WP_001096429.1 |
| Coordinates | 24974..25273 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMP06_RS20055 (OMP06_20055) | 21033..21290 | + | 258 | WP_071210684.1 | hypothetical protein | - |
| OMP06_RS20060 (OMP06_20060) | 21295..21867 | + | 573 | WP_071712043.1 | hypothetical protein | - |
| OMP06_RS20065 (OMP06_20065) | 21843..22022 | + | 180 | WP_002081921.1 | hypothetical protein | - |
| OMP06_RS20070 (OMP06_20070) | 22039..22668 | + | 630 | WP_071210686.1 | hypothetical protein | - |
| OMP06_RS20075 (OMP06_20075) | 22708..23217 | + | 510 | WP_001043200.1 | hypothetical protein | - |
| OMP06_RS20080 (OMP06_20080) | 23298..23852 | + | 555 | WP_000790086.1 | hypothetical protein | - |
| OMP06_RS20085 (OMP06_20085) | 23902..24438 | + | 537 | WP_000731980.1 | hypothetical protein | - |
| OMP06_RS20090 (OMP06_20090) | 24974..25273 | - | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
| OMP06_RS20095 (OMP06_20095) | 25273..25632 | - | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OMP06_RS20100 (OMP06_20100) | 25833..26399 | + | 567 | WP_000710385.1 | hypothetical protein | - |
| OMP06_RS20105 (OMP06_20105) | 26448..26630 | + | 183 | WP_000373385.1 | hypothetical protein | - |
| OMP06_RS20110 (OMP06_20110) | 26697..27395 | + | 699 | WP_000873190.1 | hypothetical protein | - |
| OMP06_RS20115 (OMP06_20115) | 27534..27917 | + | 384 | WP_071210698.1 | hypothetical protein | - |
| OMP06_RS20120 (OMP06_20120) | 27978..28736 | + | 759 | WP_071210697.1 | hypothetical protein | - |
| OMP06_RS20125 (OMP06_20125) | 28787..29122 | + | 336 | WP_071210696.1 | hypothetical protein | - |
| OMP06_RS20130 (OMP06_20130) | 29989..30303 | + | 315 | WP_071210660.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaOXA-23 | - | 1..124107 | 124107 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T263828 WP_000312250.1 NZ_CP110467:c25632-25273 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|