Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4259623..4260350 | Replicon | chromosome |
Accession | NZ_CP110404 | ||
Organism | Shigella sonnei strain S17BD05200 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | OKF41_RS21460 | Protein ID | WP_000550189.1 |
Coordinates | 4259623..4259937 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OKF41_RS21465 | Protein ID | WP_000560263.1 |
Coordinates | 4259934..4260350 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKF41_RS21440 (4255789) | 4255789..4256775 | - | 987 | WP_001446103.1 | Gfo/Idh/MocA family oxidoreductase | - |
OKF41_RS21445 (4256854) | 4256854..4257537 | - | 684 | WP_001183060.1 | vancomycin high temperature exclusion protein | - |
OKF41_RS21450 (4257614) | 4257614..4258117 | - | 504 | WP_001305117.1 | M48 family metallopeptidase | - |
OKF41_RS21455 (4258202) | 4258202..4259338 | + | 1137 | WP_000018685.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
OKF41_RS21460 (4259623) | 4259623..4259937 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
OKF41_RS21465 (4259934) | 4259934..4260350 | + | 417 | WP_000560263.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
OKF41_RS21470 (4260395) | 4260395..4262413 | - | 2019 | WP_000121451.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
OKF41_RS21475 (4262639) | 4262639..4264990 | - | 2352 | WP_000695471.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T263819 WP_000550189.1 NZ_CP110404:4259623-4259937 [Shigella sonnei]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14979.42 Da Isoelectric Point: 4.4547
>AT263819 WP_000560263.1 NZ_CP110404:4259934-4260350 [Shigella sonnei]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLADLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLADLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|