Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3984020..3984747 | Replicon | chromosome |
| Accession | NZ_CP110404 | ||
| Organism | Shigella sonnei strain S17BD05200 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q3YYE6 |
| Locus tag | OKF41_RS20105 | Protein ID | WP_000547563.1 |
| Coordinates | 3984436..3984747 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OKF41_RS20100 | Protein ID | WP_000126296.1 |
| Coordinates | 3984020..3984439 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OKF41_RS20080 (3979071) | 3979071..3979598 | - | 528 | WP_001078766.1 | electron transport protein HydN | - |
| OKF41_RS20085 (3979746) | 3979746..3980756 | - | 1011 | WP_001402444.1 | DNA-binding transcriptional regulator AscG | - |
| OKF41_RS20090 (3981016) | 3981016..3982473 | + | 1458 | WP_001107890.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| OKF41_RS20095 (3982482) | 3982482..3983906 | + | 1425 | WP_000110319.1 | 6-phospho-beta-glucosidase AscB | - |
| OKF41_RS20100 (3984020) | 3984020..3984439 | - | 420 | WP_000126296.1 | helix-turn-helix domain-containing protein | Antitoxin |
| OKF41_RS20105 (3984436) | 3984436..3984747 | - | 312 | WP_000547563.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OKF41_RS20110 (3984909) | 3984909..3985682 | - | 774 | WP_001026444.1 | hypothetical protein | - |
| OKF41_RS20115 (3985707) | 3985707..3986177 | - | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| OKF41_RS20120 (3986170) | 3986170..3986580 | - | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| OKF41_RS20125 (3986577) | 3986577..3987344 | - | 768 | WP_000067403.1 | formate hydrogenlyase subunit HycG | - |
| OKF41_RS20130 (3987344) | 3987344..3987886 | - | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| OKF41_RS20135 (3987896) | 3987896..3989593 | - | 1698 | WP_001288143.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.11 Da Isoelectric Point: 9.7105
>T263816 WP_000547563.1 NZ_CP110404:c3984747-3984436 [Shigella sonnei]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.38 Da Isoelectric Point: 4.3653
>AT263816 WP_000126296.1 NZ_CP110404:c3984439-3984020 [Shigella sonnei]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNQEFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNQEFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|