Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-VapI
Location 331668..332288 Replicon chromosome
Accession NZ_CP110396
Organism Paraburkholderia sp. D15

Toxin (Protein)


Gene name graT Uniprot ID -
Locus tag LFL96_RS21120 Protein ID WP_281002654.1
Coordinates 332010..332288 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag LFL96_RS21115 Protein ID WP_281002653.1
Coordinates 331668..331970 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LFL96_RS21055 (LFL96_21060) 326737..327198 + 462 WP_281002641.1 RusA family crossover junction endodeoxyribonuclease -
LFL96_RS21060 (LFL96_21065) 327195..327758 + 564 WP_281002642.1 hypothetical protein -
LFL96_RS21065 (LFL96_21070) 327755..327919 + 165 WP_281002643.1 hypothetical protein -
LFL96_RS21070 (LFL96_21075) 327923..328387 + 465 WP_281002644.1 hypothetical protein -
LFL96_RS21075 (LFL96_21080) 328384..328905 + 522 WP_281002645.1 DUF1367 family protein -
LFL96_RS21080 (LFL96_21085) 328902..329240 + 339 WP_281002646.1 DUF1364 family protein -
LFL96_RS21085 (LFL96_21090) 329237..329449 + 213 WP_281002647.1 hypothetical protein -
LFL96_RS21090 (LFL96_21095) 329451..329822 + 372 WP_281002648.1 hypothetical protein -
LFL96_RS21095 (LFL96_21100) 329819..330061 + 243 WP_281002649.1 hypothetical protein -
LFL96_RS21100 (LFL96_21105) 330074..330739 + 666 WP_281002650.1 hypothetical protein -
LFL96_RS21105 (LFL96_21110) 330844..331149 - 306 WP_281002651.1 hypothetical protein -
LFL96_RS21110 (LFL96_21115) 331261..331458 + 198 WP_281002652.1 hypothetical protein -
LFL96_RS21115 (LFL96_21120) 331668..331970 - 303 WP_281002653.1 HigA family addiction module antitoxin Antitoxin
LFL96_RS21120 (LFL96_21125) 332010..332288 - 279 WP_281002654.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LFL96_RS21135 (LFL96_21140) 332801..333301 + 501 WP_281002655.1 HGGxSTG domain-containing protein -
LFL96_RS21140 (LFL96_21145) 333291..334550 + 1260 WP_281002656.1 phage terminase large subunit -
LFL96_RS21145 (LFL96_21150) 334591..335940 + 1350 WP_281002657.1 phage portal protein -
LFL96_RS21150 (LFL96_21155) 336008..336313 + 306 WP_281002658.1 hypothetical protein -
LFL96_RS21155 (LFL96_21160) 336376..336585 + 210 WP_281002659.1 hypothetical protein -
LFL96_RS21160 (LFL96_21165) 336641..336892 + 252 WP_281002660.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 301605..383449 81844


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(1-92)

Antitoxin

Cro/C1-type helix-turn-helix domain

(22-66)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10654.09 Da        Isoelectric Point: 9.8012

>T263788 WP_281002654.1 NZ_CP110396:c332288-332010 [Paraburkholderia sp. D15]
MISSFNDRDTETLFKGTRVARFANIEKVATRKLQQLHAAATLDFLRVPPANRLELLKGDRAGQYSIRINDQWRICFRFEN
GNATNVEIVDYH

Download         Length: 279 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11080.71 Da        Isoelectric Point: 4.8430

>AT263788 WP_281002653.1 NZ_CP110396:c331970-331668 [Paraburkholderia sp. D15]
MAREIPLATPGEILALDWLEPMGITQYALAKAIDVPARRINEIVKGERSITADTAVRLAAYFGTDPQSWMSLQTHYDTEM
ARDKIGEEKLAEIKQHAVAA

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References