Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 6291865..6292477 | Replicon | chromosome |
| Accession | NZ_CP110389 | ||
| Organism | Rhodopseudomonas sp. P2A-2r | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | ONR75_RS30245 | Protein ID | WP_265080502.1 |
| Coordinates | 6291865..6292146 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | ONR75_RS30250 | Protein ID | WP_265083851.1 |
| Coordinates | 6292190..6292477 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONR75_RS30230 (ONR75_30230) | 6287127..6287930 | + | 804 | WP_265080499.1 | RMD1 family protein | - |
| ONR75_RS30235 (ONR75_30235) | 6287977..6288570 | - | 594 | WP_265080500.1 | hypothetical protein | - |
| ONR75_RS30240 (ONR75_30240) | 6288727..6291780 | + | 3054 | WP_265080501.1 | DNA polymerase I | - |
| ONR75_RS30245 (ONR75_30245) | 6291865..6292146 | + | 282 | WP_265080502.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ONR75_RS30250 (ONR75_30250) | 6292190..6292477 | + | 288 | WP_265083851.1 | HigA family addiction module antitoxin | Antitoxin |
| ONR75_RS30255 (ONR75_30255) | 6292514..6293149 | + | 636 | WP_265080503.1 | LysE family translocator | - |
| ONR75_RS30260 (ONR75_30260) | 6293598..6295604 | + | 2007 | WP_265083852.1 | EAL domain-containing protein | - |
| ONR75_RS30265 (ONR75_30265) | 6295633..6296259 | - | 627 | WP_265080504.1 | glutathione S-transferase N-terminal domain-containing protein | - |
| ONR75_RS30270 (ONR75_30270) | 6296316..6297221 | - | 906 | WP_265083853.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10577.00 Da Isoelectric Point: 9.0518
>T263783 WP_265080502.1 NZ_CP110389:6291865-6292146 [Rhodopseudomonas sp. P2A-2r]
VIKSFKIRMTQAAFDGEALKGFPAALLKVTRRRLNYLDSATSLHDLQSPPGNRLEALKGDRQGQHSIRVNDQFRICFVWT
SEGPTDVEFVDYH
VIKSFKIRMTQAAFDGEALKGFPAALLKVTRRRLNYLDSATSLHDLQSPPGNRLEALKGDRQGQHSIRVNDQFRICFVWT
SEGPTDVEFVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|