Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3326553..3327151 | Replicon | chromosome |
| Accession | NZ_CP110373 | ||
| Organism | Proteus mirabilis strain CZP26 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | I1YFL9 |
| Locus tag | ONR66_RS15560 | Protein ID | WP_001896384.1 |
| Coordinates | 3326553..3326876 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | ONR66_RS15565 | Protein ID | WP_000058216.1 |
| Coordinates | 3326873..3327151 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONR66_RS15530 (ONR66_15530) | 3322266..3322652 | - | 387 | WP_032469918.1 | TraA family conjugative transfer protein | - |
| ONR66_RS15535 (ONR66_15535) | 3322649..3323221 | - | 573 | WP_148039504.1 | type IV conjugative transfer system lipoprotein TraV | - |
| ONR66_RS15540 (ONR66_15540) | 3323296..3324585 | - | 1290 | WP_159262611.1 | TraB/VirB10 family protein | - |
| ONR66_RS15545 (ONR66_15545) | 3324588..3325484 | - | 897 | WP_159262630.1 | type-F conjugative transfer system secretin TraK | - |
| ONR66_RS15550 (ONR66_15550) | 3325468..3326094 | - | 627 | WP_159262613.1 | TraE/TraK family type IV conjugative transfer system protein | - |
| ONR66_RS15555 (ONR66_15555) | 3326091..3326372 | - | 282 | WP_000433891.1 | type IV conjugative transfer system protein TraL | - |
| ONR66_RS15560 (ONR66_15560) | 3326553..3326876 | + | 324 | WP_001896384.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ONR66_RS15565 (ONR66_15565) | 3326873..3327151 | + | 279 | WP_000058216.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| ONR66_RS15570 (ONR66_15570) | 3327177..3327812 | - | 636 | WP_000033756.1 | DUF4400 domain-containing protein | - |
| ONR66_RS15575 (ONR66_15575) | 3327799..3328359 | - | 561 | WP_159262615.1 | conjugative transfer protein | - |
| ONR66_RS15580 (ONR66_15580) | 3328369..3330189 | - | 1821 | WP_000661889.1 | conjugative transfer system coupling protein TraD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | tet(J) / sul2 / aph(3'')-Ib / aph(6)-Id / aph(3')-VIa / floR / erm(42) | - | 3228820..3417947 | 189127 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12281.33 Da Isoelectric Point: 9.7658
>T263761 WP_001896384.1 NZ_CP110373:3326553-3326876 [Proteus mirabilis]
MSWKIDFYDGVEDQILDMPPKIQARMIKLLELMEKHGANLGPPHTESMGDGLFEIRAKAQEGIGRGLFCYLKGKHIYVLH
AFVKKSQKTPKNELNLARDRQKEVQKS
MSWKIDFYDGVEDQILDMPPKIQARMIKLLELMEKHGANLGPPHTESMGDGLFEIRAKAQEGIGRGLFCYLKGKHIYVLH
AFVKKSQKTPKNELNLARDRQKEVQKS
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|