Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 3326553..3327151 Replicon chromosome
Accession NZ_CP110373
Organism Proteus mirabilis strain CZP26

Toxin (Protein)


Gene name higB Uniprot ID I1YFL9
Locus tag ONR66_RS15560 Protein ID WP_001896384.1
Coordinates 3326553..3326876 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag ONR66_RS15565 Protein ID WP_000058216.1
Coordinates 3326873..3327151 (+) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ONR66_RS15530 (ONR66_15530) 3322266..3322652 - 387 WP_032469918.1 TraA family conjugative transfer protein -
ONR66_RS15535 (ONR66_15535) 3322649..3323221 - 573 WP_148039504.1 type IV conjugative transfer system lipoprotein TraV -
ONR66_RS15540 (ONR66_15540) 3323296..3324585 - 1290 WP_159262611.1 TraB/VirB10 family protein -
ONR66_RS15545 (ONR66_15545) 3324588..3325484 - 897 WP_159262630.1 type-F conjugative transfer system secretin TraK -
ONR66_RS15550 (ONR66_15550) 3325468..3326094 - 627 WP_159262613.1 TraE/TraK family type IV conjugative transfer system protein -
ONR66_RS15555 (ONR66_15555) 3326091..3326372 - 282 WP_000433891.1 type IV conjugative transfer system protein TraL -
ONR66_RS15560 (ONR66_15560) 3326553..3326876 + 324 WP_001896384.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ONR66_RS15565 (ONR66_15565) 3326873..3327151 + 279 WP_000058216.1 helix-turn-helix transcriptional regulator Antitoxin
ONR66_RS15570 (ONR66_15570) 3327177..3327812 - 636 WP_000033756.1 DUF4400 domain-containing protein -
ONR66_RS15575 (ONR66_15575) 3327799..3328359 - 561 WP_159262615.1 conjugative transfer protein -
ONR66_RS15580 (ONR66_15580) 3328369..3330189 - 1821 WP_000661889.1 conjugative transfer system coupling protein TraD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element tet(J) / sul2 / aph(3'')-Ib / aph(6)-Id / aph(3')-VIa / floR / erm(42) - 3228820..3417947 189127


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(14-102)

Antitoxin

Cro/C1-type helix-turn-helix domain

(31-81)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12281.33 Da        Isoelectric Point: 9.7658

>T263761 WP_001896384.1 NZ_CP110373:3326553-3326876 [Proteus mirabilis]
MSWKIDFYDGVEDQILDMPPKIQARMIKLLELMEKHGANLGPPHTESMGDGLFEIRAKAQEGIGRGLFCYLKGKHIYVLH
AFVKKSQKTPKNELNLARDRQKEVQKS

Download         Length: 324 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10517.07 Da        Isoelectric Point: 9.9393

>AT263761 WP_000058216.1 NZ_CP110373:3326873-3327151 [Proteus mirabilis]
MSLQKLKQRALANAEVKNEYDKLESEFSFIDQLLTMRTKAGLTQEQVAERMHTQKSNVSRLEKGNANPSWSTLLKYAHAC
GFELTLKPQKMS

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A244CN87

Antitoxin

Source ID Structure

References