Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 110809..111407 | Replicon | chromosome |
| Accession | NZ_CP110372 | ||
| Organism | Proteus mirabilis strain CZP44 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | I1YFL9 |
| Locus tag | ONR64_RS00470 | Protein ID | WP_001896384.1 |
| Coordinates | 111084..111407 (-) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | ONR64_RS00465 | Protein ID | WP_000058216.1 |
| Coordinates | 110809..111087 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONR64_RS00450 (ONR64_00450) | 107771..109591 | + | 1821 | WP_000661889.1 | conjugative transfer system coupling protein TraD | - |
| ONR64_RS00455 (ONR64_00455) | 109601..110161 | + | 561 | WP_159262615.1 | conjugative transfer protein | - |
| ONR64_RS00460 (ONR64_00460) | 110148..110783 | + | 636 | WP_000033756.1 | DUF4400 domain-containing protein | - |
| ONR64_RS00465 (ONR64_00465) | 110809..111087 | - | 279 | WP_000058216.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| ONR64_RS00470 (ONR64_00470) | 111084..111407 | - | 324 | WP_001896384.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ONR64_RS00475 (ONR64_00475) | 111588..111869 | + | 282 | WP_000433891.1 | type IV conjugative transfer system protein TraL | - |
| ONR64_RS00480 (ONR64_00480) | 111866..112492 | + | 627 | WP_159262613.1 | TraE/TraK family type IV conjugative transfer system protein | - |
| ONR64_RS00485 (ONR64_00485) | 112476..113372 | + | 897 | WP_159262630.1 | type-F conjugative transfer system secretin TraK | - |
| ONR64_RS00490 (ONR64_00490) | 113375..114664 | + | 1290 | WP_159262611.1 | TraB/VirB10 family protein | - |
| ONR64_RS00495 (ONR64_00495) | 114739..115311 | + | 573 | WP_148039504.1 | type IV conjugative transfer system lipoprotein TraV | - |
| ONR64_RS00500 (ONR64_00500) | 115308..115694 | + | 387 | WP_032469918.1 | TraA family conjugative transfer protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | tet(J) | htpB | 1294..204974 | 203680 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12281.33 Da Isoelectric Point: 9.7658
>T263750 WP_001896384.1 NZ_CP110372:c111407-111084 [Proteus mirabilis]
MSWKIDFYDGVEDQILDMPPKIQARMIKLLELMEKHGANLGPPHTESMGDGLFEIRAKAQEGIGRGLFCYLKGKHIYVLH
AFVKKSQKTPKNELNLARDRQKEVQKS
MSWKIDFYDGVEDQILDMPPKIQARMIKLLELMEKHGANLGPPHTESMGDGLFEIRAKAQEGIGRGLFCYLKGKHIYVLH
AFVKKSQKTPKNELNLARDRQKEVQKS
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|