Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 42246..42973 | Replicon | plasmid pKP7626 |
| Accession | NZ_CP110370 | ||
| Organism | Klebsiella pneumoniae isolate KP7626 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A5Q9LNL2 |
| Locus tag | OM094_RS26390 | Protein ID | WP_004118600.1 |
| Coordinates | 42246..42557 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | V0AHC4 |
| Locus tag | OM094_RS26395 | Protein ID | WP_000990392.1 |
| Coordinates | 42554..42973 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM094_RS26370 (OM094_26370) | 38760..39479 | + | 720 | WP_001102107.1 | (Fe-S)-binding protein | - |
| OM094_RS26375 (OM094_26375) | 39490..40917 | + | 1428 | WP_000023895.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| OM094_RS26380 (OM094_26380) | 40910..41605 | + | 696 | WP_004118595.1 | lactate utilization protein C | - |
| OM094_RS26385 (OM094_26385) | 41655..42035 | - | 381 | Protein_40 | gluconate permease | - |
| OM094_RS26390 (OM094_26390) | 42246..42557 | + | 312 | WP_004118600.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OM094_RS26395 (OM094_26395) | 42554..42973 | + | 420 | WP_000990392.1 | helix-turn-helix domain-containing protein | Antitoxin |
| OM094_RS26400 (OM094_26400) | 43010..44212 | - | 1203 | WP_003031541.1 | hypothetical protein | - |
| OM094_RS26405 (OM094_26405) | 44205..44534 | - | 330 | WP_094309446.1 | baseplate protein | - |
| OM094_RS26410 (OM094_26410) | 44531..45190 | - | 660 | WP_000078540.1 | hypothetical protein | - |
| OM094_RS26415 (OM094_26415) | 45614..45970 | - | 357 | WP_077253206.1 | Ref family recombination enhancement nuclease | - |
| OM094_RS26420 (OM094_26420) | 46090..46230 | - | 141 | WP_004118614.1 | hypothetical protein | - |
| OM094_RS26425 (OM094_26425) | 46523..46876 | + | 354 | WP_001114073.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| OM094_RS26430 (OM094_26430) | 46924..47286 | + | 363 | WP_020324593.1 | arsenite efflux transporter metallochaperone ArsD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qnrS1 / sul1 / blaDHA-1 / qacE / dfrA1 / tet(A) | - | 1..227378 | 227378 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12386.14 Da Isoelectric Point: 10.0935
>T263745 WP_004118600.1 NZ_CP110370:42246-42557 [Klebsiella pneumoniae]
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15534.71 Da Isoelectric Point: 4.4702
>AT263745 WP_000990392.1 NZ_CP110370:42554-42973 [Klebsiella pneumoniae]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Q9LNL2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AHC4 |