Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3904041..3904638 | Replicon | chromosome |
Accession | NZ_CP110369 | ||
Organism | Klebsiella pneumoniae isolate KP7626 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | OM094_RS19180 | Protein ID | WP_004142563.1 |
Coordinates | 3904321..3904638 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | OM094_RS19175 | Protein ID | WP_004142561.1 |
Coordinates | 3904041..3904328 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM094_RS19145 (3900122) | 3900122..3900370 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
OM094_RS19150 (3900388) | 3900388..3900729 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
OM094_RS19155 (3900760) | 3900760..3901875 | - | 1116 | WP_020316605.1 | MBL fold metallo-hydrolase | - |
OM094_RS19160 (3902054) | 3902054..3902635 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
OM094_RS19165 (3902635) | 3902635..3903003 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
OM094_RS19170 (3903123) | 3903123..3903776 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
OM094_RS19175 (3904041) | 3904041..3904328 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OM094_RS19180 (3904321) | 3904321..3904638 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OM094_RS19185 (3904823) | 3904823..3905866 | - | 1044 | WP_032419264.1 | DUF2157 domain-containing protein | - |
OM094_RS19190 (3906533) | 3906533..3907399 | - | 867 | WP_032419265.1 | helix-turn-helix transcriptional regulator | - |
OM094_RS19195 (3907508) | 3907508..3908935 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T263739 WP_004142563.1 NZ_CP110369:c3904638-3904321 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |