Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3635650..3636325 | Replicon | chromosome |
| Accession | NZ_CP110354 | ||
| Organism | Enterobacter hormaechei strain ECC2783 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OLI86_RS17610 | Protein ID | WP_032619177.1 |
| Coordinates | 3635650..3635949 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A2J0PXC9 |
| Locus tag | OLI86_RS17615 | Protein ID | WP_015571639.1 |
| Coordinates | 3635960..3636325 (+) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLI86_RS17590 (OLI86_17590) | 3630782..3631399 | - | 618 | WP_032634496.1 | DUF1819 family protein | - |
| OLI86_RS17595 (OLI86_17595) | 3631563..3632531 | - | 969 | WP_000654804.1 | IS5-like element IS903B family transposase | - |
| OLI86_RS17600 (OLI86_17600) | 3632594..3634219 | + | 1626 | WP_230199853.1 | ATP-binding cassette domain-containing protein | - |
| OLI86_RS17605 (OLI86_17605) | 3634200..3635399 | + | 1200 | WP_017382757.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
| OLI86_RS17610 (OLI86_17610) | 3635650..3635949 | + | 300 | WP_032619177.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OLI86_RS17615 (OLI86_17615) | 3635960..3636325 | + | 366 | WP_015571639.1 | HigA family addiction module antitoxin | Antitoxin |
| OLI86_RS17620 (OLI86_17620) | 3636352..3637533 | - | 1182 | WP_032619175.1 | PLP-dependent aminotransferase family protein | - |
| OLI86_RS17625 (OLI86_17625) | 3637554..3638441 | - | 888 | WP_032619173.1 | LysR family transcriptional regulator | - |
| OLI86_RS17630 (OLI86_17630) | 3638539..3639141 | + | 603 | WP_017382759.1 | short chain dehydrogenase | - |
| OLI86_RS17635 (OLI86_17635) | 3639138..3639869 | - | 732 | WP_017382760.1 | methyltransferase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3631563..3632486 | 923 | |
| - | inside | Prophage | - | - | 3631563..3657280 | 25717 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11564.19 Da Isoelectric Point: 9.6776
>T263705 WP_032619177.1 NZ_CP110354:3635650-3635949 [Enterobacter hormaechei]
MINHSRDQWLEDFFLYGRSSNVIPLNLETALARKLDIINAAMSHLDLRSPPGNMYEALSPPLKGYSSIRVNRQYRLVFRW
SEGKADDLYLSPHKYTQHK
MINHSRDQWLEDFFLYGRSSNVIPLNLETALARKLDIINAAMSHLDLRSPPGNMYEALSPPLKGYSSIRVNRQYRLVFRW
SEGKADDLYLSPHKYTQHK
Download Length: 300 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13705.73 Da Isoelectric Point: 9.5936
>AT263705 WP_015571639.1 NZ_CP110354:3635960-3636325 [Enterobacter hormaechei]
MTLQQALRKPTTPGEVLQYEYLEPLNLKINDLAEMLNVHRNTVSALVNNNRKLTADMAIKLAKAFNTTIEFWLNLQLNVD
IWEAQSNSRTQEELSRIKTVAEVMAKRKSGKPDVTLHGNSA
MTLQQALRKPTTPGEVLQYEYLEPLNLKINDLAEMLNVHRNTVSALVNNNRKLTADMAIKLAKAFNTTIEFWLNLQLNVD
IWEAQSNSRTQEELSRIKTVAEVMAKRKSGKPDVTLHGNSA
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|