Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3008257..3008917 | Replicon | chromosome |
Accession | NZ_CP110354 | ||
Organism | Enterobacter hormaechei strain ECC2783 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A2J0Q4X0 |
Locus tag | OLI86_RS14720 | Protein ID | WP_017383312.1 |
Coordinates | 3008564..3008917 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A2J0Q4Z7 |
Locus tag | OLI86_RS14715 | Protein ID | WP_017383313.1 |
Coordinates | 3008257..3008559 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLI86_RS14700 (OLI86_14700) | 3004431..3005756 | + | 1326 | WP_032619371.1 | SidA/IucD/PvdA family monooxygenase | - |
OLI86_RS14705 (OLI86_14705) | 3005783..3007972 | + | 2190 | WP_023303946.1 | TonB-dependent siderophore receptor | - |
OLI86_RS14715 (OLI86_14715) | 3008257..3008559 | - | 303 | WP_017383313.1 | XRE family transcriptional regulator | Antitoxin |
OLI86_RS14720 (OLI86_14720) | 3008564..3008917 | - | 354 | WP_017383312.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OLI86_RS14725 (OLI86_14725) | 3009108..3010058 | - | 951 | WP_032619370.1 | HTH-type transcriptional regulator Cbl | - |
OLI86_RS14730 (OLI86_14730) | 3010155..3011072 | - | 918 | WP_003859531.1 | nitrogen assimilation transcriptional regulator NAC | - |
OLI86_RS14740 (OLI86_14740) | 3011604..3012536 | - | 933 | WP_023303950.1 | L,D-transpeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13537.37 Da Isoelectric Point: 9.9538
>T263704 WP_017383312.1 NZ_CP110354:c3008917-3008564 [Enterobacter hormaechei]
VWAIKTTDRFDDWFTSLNDSERASVLAALLVLRERGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
VLCAGNKVGNERRFYDEMLLVADREYTRWLNTLKERN
VWAIKTTDRFDDWFTSLNDSERASVLAALLVLRERGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
VLCAGNKVGNERRFYDEMLLVADREYTRWLNTLKERN
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J0Q4X0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J0Q4Z7 |