Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 36286..37016 | Replicon | chromosome |
Accession | NZ_CP110354 | ||
Organism | Enterobacter hormaechei strain ECC2783 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A837FIL2 |
Locus tag | OLI86_RS00170 | Protein ID | WP_023302825.1 |
Coordinates | 36286..36600 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OLI86_RS00175 | Protein ID | WP_032620773.1 |
Coordinates | 36600..37016 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLI86_RS00150 (OLI86_00150) | 31952..33037 | + | 1086 | Protein_29 | cellulase family glycosylhydrolase | - |
OLI86_RS00155 (OLI86_00155) | 32943..34127 | - | 1185 | WP_015570118.1 | multidrug efflux MFS transporter EmrD | - |
OLI86_RS00160 (OLI86_00160) | 34303..35136 | - | 834 | WP_032620535.1 | DMT family transporter | - |
OLI86_RS00165 (OLI86_00165) | 35199..35645 | - | 447 | WP_003861064.1 | GNAT family N-acetyltransferase | - |
OLI86_RS00170 (OLI86_00170) | 36286..36600 | + | 315 | WP_023302825.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
OLI86_RS00175 (OLI86_00175) | 36600..37016 | + | 417 | WP_032620773.1 | helix-turn-helix domain-containing protein | Antitoxin |
OLI86_RS00180 (OLI86_00180) | 37163..37261 | + | 99 | WP_057979964.1 | ilvB operon leader peptide IvbL | - |
OLI86_RS00185 (OLI86_00185) | 37368..39056 | + | 1689 | WP_023302827.1 | acetolactate synthase large subunit | - |
OLI86_RS00190 (OLI86_00190) | 39060..39347 | + | 288 | WP_015570113.1 | acetolactate synthase small subunit | - |
OLI86_RS00195 (OLI86_00195) | 39473..40066 | + | 594 | WP_003861054.1 | transcriptional regulator UhpA | - |
OLI86_RS00200 (OLI86_00200) | 40063..41568 | + | 1506 | WP_032634219.1 | signal transduction histidine-protein kinase/phosphatase UhpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12415.51 Da Isoelectric Point: 10.2825
>T263697 WP_023302825.1 NZ_CP110354:36286-36600 [Enterobacter hormaechei]
MHLISMKAILDAVSQFPQHREELLFLGRVIEKSHCPTPAALRKLFPTLDNFKYLDKHYVIDIANNNLRVVALIFFESQKF
YVRHVFTHKEYDRFTEKHRTKGKK
MHLISMKAILDAVSQFPQHREELLFLGRVIEKSHCPTPAALRKLFPTLDNFKYLDKHYVIDIANNNLRVVALIFFESQKF
YVRHVFTHKEYDRFTEKHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15249.77 Da Isoelectric Point: 5.2068
>AT263697 WP_032620773.1 NZ_CP110354:36600-37016 [Enterobacter hormaechei]
MIVADAMKATHALVAAVPLLGEQPSEKDYKDALELVEYLLMNEPNSPLLDIVCARISHYEANGPEIVALRKEMESVPVGI
AVLRTLMDQYNLTISDFKDEIGSKSMVSRVLNGQRQLTLNHIKKLAARFGVSPALFIE
MIVADAMKATHALVAAVPLLGEQPSEKDYKDALELVEYLLMNEPNSPLLDIVCARISHYEANGPEIVALRKEMESVPVGI
AVLRTLMDQYNLTISDFKDEIGSKSMVSRVLNGQRQLTLNHIKKLAARFGVSPALFIE
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|