Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5514623..5515218 | Replicon | chromosome |
| Accession | NZ_CP110353 | ||
| Organism | Pseudomonas aeruginosa strain PALA48 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PALA48_RS25885 | Protein ID | WP_071538299.1 |
| Coordinates | 5514940..5515218 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA48_RS25880 | Protein ID | WP_003123432.1 |
| Coordinates | 5514623..5514928 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA48_RS25845 (PALA48_05128) | 5509763..5510611 | + | 849 | WP_003123430.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| PALA48_RS25855 (PALA48_05130) | 5510778..5511719 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| PALA48_RS25860 (PALA48_05131) | 5511836..5512450 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| PALA48_RS25865 (PALA48_05132) | 5512492..5513076 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| PALA48_RS25870 (PALA48_05133) | 5513117..5514217 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| PALA48_RS25880 (PALA48_05135) | 5514623..5514928 | - | 306 | WP_003123432.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA48_RS25885 | 5514940..5515218 | - | 279 | WP_071538299.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA48_RS25890 | 5515271..5515399 | - | 129 | Protein_5114 | integrase | - |
| PALA48_RS25895 (PALA48_05136) | 5515547..5517775 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
| PALA48_RS25900 (PALA48_05137) | 5517845..5518492 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA48_RS25905 (PALA48_05138) | 5518554..5519792 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10616.17 Da Isoelectric Point: 7.8937
>T263696 WP_071538299.1 NZ_CP110353:c5515218-5514940 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHGIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHGIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|