Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5548762..5549357 | Replicon | chromosome |
Accession | NZ_CP110352 | ||
Organism | Pseudomonas aeruginosa strain PALA47 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | PALA47_RS25790 | Protein ID | WP_003113526.1 |
Coordinates | 5549079..5549357 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA47_RS25785 | Protein ID | WP_003099268.1 |
Coordinates | 5548762..5549067 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA47_RS25750 (PALA47_05093) | 5543901..5544749 | + | 849 | WP_003099284.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
PALA47_RS25760 (PALA47_05095) | 5544916..5545857 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
PALA47_RS25765 (PALA47_05096) | 5545974..5546588 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
PALA47_RS25770 (PALA47_05097) | 5546630..5547214 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
PALA47_RS25775 (PALA47_05098) | 5547255..5548355 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
PALA47_RS25785 (PALA47_05100) | 5548762..5549067 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PALA47_RS25790 | 5549079..5549357 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA47_RS25795 | 5549410..5549538 | - | 129 | Protein_5097 | integrase | - |
PALA47_RS25800 (PALA47_05101) | 5549686..5551914 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
PALA47_RS25805 (PALA47_05102) | 5551984..5552631 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA47_RS25810 (PALA47_05103) | 5552693..5553931 | - | 1239 | WP_003099263.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T263689 WP_003113526.1 NZ_CP110352:c5549357-5549079 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|