Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 6054569..6055164 | Replicon | chromosome |
Accession | NZ_CP110349 | ||
Organism | Pseudomonas aeruginosa strain PALA40 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | PALA40_RS28595 | Protein ID | WP_003117425.1 |
Coordinates | 6054886..6055164 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA40_RS28590 | Protein ID | WP_003099268.1 |
Coordinates | 6054569..6054874 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA40_RS28560 (PALA40_05635) | 6050022..6050312 | - | 291 | WP_023083237.1 | DUF5447 family protein | - |
PALA40_RS28565 (PALA40_05636) | 6050524..6050796 | - | 273 | WP_003115921.1 | hypothetical protein | - |
PALA40_RS28570 (PALA40_05637) | 6050906..6051172 | + | 267 | WP_016852153.1 | hypothetical protein | - |
PALA40_RS28575 (PALA40_05638) | 6051304..6052140 | + | 837 | WP_223656480.1 | helix-turn-helix domain-containing protein | - |
PALA40_RS28580 (PALA40_05639) | 6052115..6053653 | + | 1539 | WP_023082696.1 | GNAT family N-acetyltransferase | - |
PALA40_RS28585 | 6053665..6054192 | - | 528 | WP_071535723.1 | ATP-binding protein | - |
PALA40_RS28590 (PALA40_05640) | 6054569..6054874 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PALA40_RS28595 | 6054886..6055164 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA40_RS28600 | 6055217..6055345 | - | 129 | Protein_5657 | integrase | - |
PALA40_RS28605 (PALA40_05641) | 6055493..6057721 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
PALA40_RS28610 (PALA40_05642) | 6057791..6058438 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA40_RS28615 (PALA40_05643) | 6058500..6059738 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T263670 WP_003117425.1 NZ_CP110349:c6055164-6054886 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|