Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5817845..5818440 | Replicon | chromosome |
Accession | NZ_CP110348 | ||
Organism | Pseudomonas aeruginosa strain PALA36 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A9E8L6K5 |
Locus tag | PALA36_RS27490 | Protein ID | WP_071534386.1 |
Coordinates | 5818162..5818440 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA36_RS27485 | Protein ID | WP_003133769.1 |
Coordinates | 5817845..5818150 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA36_RS27460 (PALA36_05413) | 5813118..5815043 | - | 1926 | WP_023085762.1 | DUF3732 domain-containing protein | - |
PALA36_RS27465 | 5815040..5815507 | - | 468 | WP_124075005.1 | DUF6521 family protein | - |
PALA36_RS27470 | 5815504..5815875 | - | 372 | WP_269973048.1 | hypothetical protein | - |
PALA36_RS27475 (PALA36_05414) | 5815967..5816398 | - | 432 | WP_003460108.1 | IS200/IS605 family transposase | - |
PALA36_RS27480 (PALA36_05415) | 5816338..5817198 | - | 861 | WP_269973049.1 | hypothetical protein | - |
PALA36_RS27485 (PALA36_05416) | 5817845..5818150 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
PALA36_RS27490 | 5818162..5818440 | - | 279 | WP_071534386.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA36_RS27495 | 5818493..5818615 | - | 123 | Protein_5434 | integrase | - |
PALA36_RS27500 (PALA36_05417) | 5818763..5820991 | + | 2229 | WP_034005476.1 | TonB-dependent receptor | - |
PALA36_RS27505 (PALA36_05418) | 5821061..5821708 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA36_RS27510 (PALA36_05419) | 5821770..5823008 | - | 1239 | WP_003111578.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 5815967..5816398 | 431 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10698.23 Da Isoelectric Point: 7.9184
>T263662 WP_071534386.1 NZ_CP110348:c5818440-5818162 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMHHAATELRDLRSPPGNRLEPLQGKRVGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMHHAATELRDLRSPPGNRLEPLQGKRVGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|