Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5223911..5224506 | Replicon | chromosome |
| Accession | NZ_CP110347 | ||
| Organism | Pseudomonas aeruginosa strain PALA52 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PALA52_RS24125 | Protein ID | WP_071535843.1 |
| Coordinates | 5224228..5224506 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA52_RS24120 | Protein ID | WP_024947077.1 |
| Coordinates | 5223911..5224216 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA52_RS24090 | 5219870..5220160 | - | 291 | WP_031627909.1 | DUF5447 family protein | - |
| PALA52_RS24095 (PALA52_04784) | 5220336..5220608 | - | 273 | WP_023086662.1 | hypothetical protein | - |
| PALA52_RS24100 (PALA52_04785) | 5220718..5220984 | + | 267 | WP_023088595.1 | hypothetical protein | - |
| PALA52_RS24105 | 5221040..5221375 | + | 336 | WP_028680759.1 | hypothetical protein | - |
| PALA52_RS24110 (PALA52_04786) | 5221495..5222928 | - | 1434 | WP_020750803.1 | hypothetical protein | - |
| PALA52_RS24115 | 5223191..5223574 | - | 384 | WP_003111574.1 | hypothetical protein | - |
| PALA52_RS24120 (PALA52_04787) | 5223911..5224216 | - | 306 | WP_024947077.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA52_RS24125 | 5224228..5224506 | - | 279 | WP_071535843.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA52_RS24130 | 5224559..5224681 | - | 123 | Protein_4764 | integrase | - |
| PALA52_RS24135 (PALA52_04788) | 5224835..5227063 | + | 2229 | WP_121367217.1 | TonB-dependent receptor | - |
| PALA52_RS24140 (PALA52_04789) | 5227134..5227781 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA52_RS24145 (PALA52_04790) | 5227843..5229081 | - | 1239 | WP_121501150.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10674.25 Da Isoelectric Point: 7.8937
>T263656 WP_071535843.1 NZ_CP110347:c5224506-5224228 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRVGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRVGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|