Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 1247718..1248340 | Replicon | chromosome |
| Accession | NZ_CP110346 | ||
| Organism | Pseudomonas aeruginosa strain PALA35 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PALA35_RS05860 | Protein ID | WP_023910260.1 |
| Coordinates | 1247718..1248032 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA35_RS05865 | Protein ID | WP_263464183.1 |
| Coordinates | 1248035..1248340 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA35_RS05835 | 1242735..1243892 | + | 1158 | Protein_1155 | IS3 family transposase | - |
| PALA35_RS05840 (PALA35_01167) | 1244472..1245428 | + | 957 | WP_263464185.1 | site-specific integrase | - |
| PALA35_RS05845 (PALA35_01168) | 1245497..1245808 | + | 312 | WP_031631670.1 | outer membrane protein assembly factor BamE | - |
| PALA35_RS05850 (PALA35_01169) | 1245939..1246589 | + | 651 | WP_263464184.1 | BRCT domain-containing protein | - |
| PALA35_RS05855 (PALA35_01170) | 1246711..1247469 | + | 759 | WP_033967231.1 | KilA-N domain-containing protein | - |
| PALA35_RS05860 (PALA35_01172) | 1247718..1248032 | + | 315 | WP_023910260.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA35_RS05865 (PALA35_01173) | 1248035..1248340 | + | 306 | WP_263464183.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PALA35_RS05870 (PALA35_01174) | 1248401..1248703 | - | 303 | WP_073665794.1 | hypothetical protein | - |
| PALA35_RS05875 (PALA35_01175) | 1248700..1249413 | - | 714 | WP_235175899.1 | hypothetical protein | - |
| PALA35_RS05880 (PALA35_01176) | 1249410..1249601 | - | 192 | WP_021205282.1 | hypothetical protein | - |
| PALA35_RS05885 (PALA35_01178) | 1249857..1250285 | - | 429 | WP_019486521.1 | hypothetical protein | - |
| PALA35_RS05890 (PALA35_01179) | 1250330..1251166 | - | 837 | WP_003085692.1 | prohibitin family protein | - |
| PALA35_RS05895 (PALA35_01180) | 1251163..1251417 | - | 255 | WP_003085694.1 | hypothetical protein | - |
| PALA35_RS05900 (PALA35_01181) | 1251517..1251750 | - | 234 | WP_123788651.1 | hypothetical protein | - |
| PALA35_RS05905 (PALA35_01182) | 1251753..1252139 | - | 387 | WP_123788652.1 | LuxR C-terminal-related transcriptional regulator | - |
| PALA35_RS05910 | 1252570..1253103 | - | 534 | WP_071548365.1 | PIN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1242863..1287371 | 44508 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11776.54 Da Isoelectric Point: 9.4385
>T263645 WP_023910260.1 NZ_CP110346:1247718-1248032 [Pseudomonas aeruginosa]
MIFIETPVFTKRILALVDDETYRKLQEDLTLHPDAGVVIEGTGGVRKIRIAANGHGKRGGARVIYYHFTSASQIAFLLAY
DKASQEDLTADQKKMLRQIVENWR
MIFIETPVFTKRILALVDDETYRKLQEDLTLHPDAGVVIEGTGGVRKIRIAANGHGKRGGARVIYYHFTSASQIAFLLAY
DKASQEDLTADQKKMLRQIVENWR
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|