Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5783103..5783698 | Replicon | chromosome |
| Accession | NZ_CP110345 | ||
| Organism | Pseudomonas aeruginosa strain PALA30 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | PALA30_RS27245 | Protein ID | WP_003113526.1 |
| Coordinates | 5783420..5783698 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0S3KUN4 |
| Locus tag | PALA30_RS27240 | Protein ID | WP_003111575.1 |
| Coordinates | 5783103..5783408 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA30_RS27205 (PALA30_05358) | 5778244..5779092 | + | 849 | WP_009878189.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| PALA30_RS27215 (PALA30_05360) | 5779259..5780200 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| PALA30_RS27220 (PALA30_05361) | 5780317..5780931 | + | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| PALA30_RS27225 (PALA30_05362) | 5780973..5781557 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| PALA30_RS27230 (PALA30_05363) | 5781598..5782698 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| PALA30_RS27240 (PALA30_05365) | 5783103..5783408 | - | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA30_RS27245 | 5783420..5783698 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA30_RS27250 | 5783751..5783879 | - | 129 | Protein_5388 | integrase | - |
| PALA30_RS27255 (PALA30_05366) | 5784027..5786255 | + | 2229 | WP_034036795.1 | TonB-dependent receptor | - |
| PALA30_RS27260 (PALA30_05367) | 5786325..5786972 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA30_RS27265 (PALA30_05368) | 5787034..5788272 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T263642 WP_003113526.1 NZ_CP110345:c5783698-5783420 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V6ALY3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3KUN4 |