Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 5077594..5078275 | Replicon | chromosome |
| Accession | NZ_CP110345 | ||
| Organism | Pseudomonas aeruginosa strain PALA30 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6AKP0 |
| Locus tag | PALA30_RS23995 | Protein ID | WP_003111825.1 |
| Coordinates | 5077910..5078275 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA30_RS23990 | Protein ID | WP_003145733.1 |
| Coordinates | 5077594..5077917 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA30_RS23965 (PALA30_04717) | 5073507..5074145 | + | 639 | WP_003163192.1 | hypothetical protein | - |
| PALA30_RS23970 (PALA30_04718) | 5074388..5074723 | + | 336 | WP_003140884.1 | TM2 domain-containing protein | - |
| PALA30_RS23975 (PALA30_04719) | 5074897..5075415 | + | 519 | WP_003140886.1 | PAAR domain-containing protein | - |
| PALA30_RS23980 (PALA30_04720) | 5075412..5076113 | + | 702 | WP_003111822.1 | VRR-NUC domain-containing protein | - |
| PALA30_RS23985 (PALA30_04721) | 5076130..5077218 | + | 1089 | WP_058176146.1 | DUF3396 domain-containing protein | - |
| PALA30_RS23990 (PALA30_04722) | 5077594..5077917 | - | 324 | WP_003145733.1 | XRE family transcriptional regulator | Antitoxin |
| PALA30_RS23995 | 5077910..5078275 | - | 366 | WP_003111825.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA30_RS24000 | 5078539..5078778 | - | 240 | WP_044060930.1 | hypothetical protein | - |
| PALA30_RS24005 (PALA30_04723) | 5078985..5079257 | + | 273 | WP_033954259.1 | hypothetical protein | - |
| PALA30_RS24010 (PALA30_04724) | 5079288..5079713 | - | 426 | WP_003116492.1 | VOC family protein | - |
| PALA30_RS24015 (PALA30_04725) | 5079814..5080698 | + | 885 | WP_033939105.1 | LysR substrate-binding domain-containing protein | - |
| PALA30_RS24020 (PALA30_04726) | 5080671..5081624 | - | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
| PALA30_RS24025 (PALA30_04727) | 5081845..5082279 | + | 435 | WP_003114204.1 | RidA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 5064524..5080698 | 16174 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13880.24 Da Isoelectric Point: 4.8219
>T263641 WP_003111825.1 NZ_CP110345:c5078275-5077910 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|