Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 2845527..2846302 | Replicon | chromosome |
| Accession | NZ_CP110345 | ||
| Organism | Pseudomonas aeruginosa strain PALA30 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V6ADY6 |
| Locus tag | PALA30_RS13655 | Protein ID | WP_009518525.1 |
| Coordinates | 2845844..2846302 (+) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | V6AEP7 |
| Locus tag | PALA30_RS13650 | Protein ID | WP_023098543.1 |
| Coordinates | 2845527..2845844 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA30_RS13630 (PALA30_02693) | 2840700..2842085 | - | 1386 | Protein_2693 | efflux RND transporter permease subunit | - |
| PALA30_RS13635 (PALA30_02694) | 2842222..2843133 | + | 912 | WP_023098540.1 | NAD(P)H-binding protein | - |
| PALA30_RS13640 | 2843282..2843428 | + | 147 | WP_023098541.1 | MerR family DNA-binding transcriptional regulator | - |
| PALA30_RS13645 (PALA30_02696) | 2843410..2845227 | - | 1818 | WP_023098542.1 | MobH family relaxase | - |
| PALA30_RS13650 (PALA30_02697) | 2845527..2845844 | + | 318 | WP_023098543.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| PALA30_RS13655 (PALA30_02698) | 2845844..2846302 | + | 459 | WP_009518525.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| PALA30_RS13660 (PALA30_02699) | 2846329..2846706 | + | 378 | WP_009518524.1 | DUF3742 family protein | - |
| PALA30_RS13665 (PALA30_02700) | 2846722..2848239 | - | 1518 | WP_009518523.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| PALA30_RS13670 (PALA30_02701) | 2848254..2848613 | - | 360 | WP_009518522.1 | hypothetical protein | - |
| PALA30_RS13675 (PALA30_02702) | 2848610..2850004 | - | 1395 | WP_009518521.1 | integrating conjugative element protein | - |
| PALA30_RS13680 (PALA30_02703) | 2850014..2850961 | - | 948 | WP_009518520.1 | TIGR03756 family integrating conjugative element protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2775080..2910396 | 135316 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17660.02 Da Isoelectric Point: 10.1848
>T263637 WP_009518525.1 NZ_CP110345:2845844-2846302 [Pseudomonas aeruginosa]
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
Download Length: 459 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|