Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 2844899..2845494 | Replicon | chromosome |
Accession | NZ_CP110344 | ||
Organism | Pseudomonas aeruginosa strain PALA24 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PALA24_RS13635 | Protein ID | WP_071536079.1 |
Coordinates | 2844899..2845177 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA24_RS13640 | Protein ID | WP_003099268.1 |
Coordinates | 2845189..2845494 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA24_RS13615 (PALA24_02711) | 2840325..2841563 | + | 1239 | WP_003113524.1 | dipeptidase | - |
PALA24_RS13620 (PALA24_02712) | 2841625..2842272 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA24_RS13625 (PALA24_02713) | 2842342..2844570 | - | 2229 | WP_003121052.1 | TonB-dependent receptor | - |
PALA24_RS13630 | 2844718..2844846 | + | 129 | Protein_2688 | integrase | - |
PALA24_RS13635 | 2844899..2845177 | + | 279 | WP_071536079.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA24_RS13640 (PALA24_02714) | 2845189..2845494 | + | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PALA24_RS13650 (PALA24_02716) | 2846158..2846370 | + | 213 | WP_021264081.1 | AlpA family phage regulatory protein | - |
PALA24_RS13655 (PALA24_02717) | 2846409..2847431 | + | 1023 | WP_023109374.1 | replication protein RepA | - |
PALA24_RS13660 (PALA24_02718) | 2847986..2848420 | - | 435 | WP_008175821.1 | Cd(II)/Pb(II)-responsive transcriptional regulator | - |
PALA24_RS13665 (PALA24_02719) | 2848519..2849415 | + | 897 | WP_031633678.1 | cation transporter | - |
PALA24_RS13670 (PALA24_02720) | 2849558..2850319 | + | 762 | WP_009686175.1 | ZIP family metal transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10632.17 Da Isoelectric Point: 7.8937
>T263630 WP_071536079.1 NZ_CP110344:2844899-2845177 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAGTELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAGTELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|