Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 2604858..2605486 | Replicon | chromosome |
Accession | NZ_CP110344 | ||
Organism | Pseudomonas aeruginosa strain PALA24 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PALA24_RS12520 | Protein ID | WP_269971931.1 |
Coordinates | 2605163..2605486 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A8I0SEX5 |
Locus tag | PALA24_RS12515 | Protein ID | WP_003116648.1 |
Coordinates | 2604858..2605166 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA24_RS12495 (PALA24_02486) | 2600536..2600844 | + | 309 | Protein_2467 | phosphate-starvation-inducible PsiE family protein | - |
PALA24_RS12500 (PALA24_02487) | 2600831..2601793 | + | 963 | WP_003116644.1 | zinc metalloprotease HtpX | - |
PALA24_RS12505 (PALA24_02488) | 2601813..2602964 | + | 1152 | WP_003116645.1 | trypsin-like peptidase domain-containing protein | - |
PALA24_RS12510 (PALA24_02489) | 2603602..2604471 | + | 870 | WP_003116646.1 | LysR family transcriptional regulator | - |
PALA24_RS12515 (PALA24_02490) | 2604858..2605166 | - | 309 | WP_003116648.1 | transcriptional regulator | Antitoxin |
PALA24_RS12520 | 2605163..2605486 | - | 324 | WP_269971931.1 | toxin | Toxin |
PALA24_RS12530 | 2606707..2607063 | + | 357 | WP_269971923.1 | hypothetical protein | - |
PALA24_RS12535 (PALA24_02493) | 2607060..2607938 | + | 879 | WP_010791768.1 | hypothetical protein | - |
PALA24_RS12540 | 2608001..2608648 | + | 648 | WP_269971924.1 | hypothetical protein | - |
PALA24_RS12550 | 2609847..2610242 | + | 396 | WP_269971925.1 | restriction endonuclease | - |
PALA24_RS12555 | 2610247..2610459 | + | 213 | WP_031684089.1 | AlpA family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2584504..2631102 | 46598 | |
- | inside | IScluster/Tn | - | - | 2599604..2615069 | 15465 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12523.20 Da Isoelectric Point: 10.1546
>T263629 WP_269971931.1 NZ_CP110344:c2605486-2605163 [Pseudomonas aeruginosa]
MSPFERNRKAHLDDDEYSLFQQMLLTNPEAGAVIANSGGLRKVRFGSVRRSKGKRGGVRVIYYYWHSGLQFWLFTLYDKD
ELDDLSSDQRRQLKALLEREVKARQTP
MSPFERNRKAHLDDDEYSLFQQMLLTNPEAGAVIANSGGLRKVRFGSVRRSKGKRGGVRVIYYYWHSGLQFWLFTLYDKD
ELDDLSSDQRRQLKALLEREVKARQTP
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|