Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-MqsA
Location 4086082..4086673 Replicon chromosome
Accession NZ_CP110342
Organism Marinobacter sp. AN1

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag LJ360_RS18795 Protein ID WP_091853968.1
Coordinates 4086082..4086393 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag LJ360_RS18800 Protein ID WP_012137897.1
Coordinates 4086386..4086673 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LJ360_RS18765 (LJ360_18765) 4082024..4082479 + 456 WP_264994735.1 hypothetical protein -
LJ360_RS18770 (LJ360_18770) 4082552..4083307 - 756 WP_264994736.1 IS21-like element helper ATPase IstB -
LJ360_RS18775 (LJ360_18775) 4083322..4084866 - 1545 WP_264994737.1 IS21 family transposase -
LJ360_RS18780 (LJ360_18780) 4085023..4085271 + 249 WP_264994738.1 hypothetical protein -
LJ360_RS18785 (LJ360_18785) 4085331..4085648 - 318 WP_264994739.1 CcdB family protein -
LJ360_RS18790 (LJ360_18790) 4085648..4085893 - 246 WP_091853970.1 type II toxin-antitoxin system CcdA family antitoxin -
LJ360_RS18795 (LJ360_18795) 4086082..4086393 + 312 WP_091853968.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LJ360_RS18800 (LJ360_18800) 4086386..4086673 + 288 WP_012137897.1 type II toxin-antitoxin system MqsA family antitoxin Antitoxin
LJ360_RS18805 (LJ360_18805) 4086834..4087076 + 243 WP_058092928.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
LJ360_RS18810 (LJ360_18810) 4087073..4087336 + 264 WP_091853965.1 Txe/YoeB family addiction module toxin -
LJ360_RS18815 (LJ360_18815) 4087479..4087736 + 258 WP_091853963.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
LJ360_RS18820 (LJ360_18820) 4087724..4088026 + 303 WP_091853961.1 type II toxin-antitoxin system RelE/ParE family toxin -
LJ360_RS18825 (LJ360_18825) 4088175..4088399 + 225 WP_091853959.1 addiction module protein -
LJ360_RS18830 (LJ360_18830) 4088396..4088689 + 294 WP_091853957.1 type II toxin-antitoxin system RelE/ParE family toxin -
LJ360_RS18835 (LJ360_18835) 4088791..4089189 + 399 WP_264994740.1 VOC family protein -
LJ360_RS18840 (LJ360_18840) 4089343..4089744 + 402 WP_264994741.1 GFA family protein -
LJ360_RS18845 (LJ360_18845) 4089805..4090251 - 447 WP_177186078.1 DUF4124 domain-containing protein -
LJ360_RS18850 (LJ360_18850) 4090376..4091407 + 1032 WP_091853951.1 DUF2157 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(43-97)

Antitoxin

Antitoxin MqsA/HigA-2

(33-94)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 11619.41 Da        Isoelectric Point: 10.1463

>T263623 WP_091853968.1 NZ_CP110342:4086082-4086393 [Marinobacter sp. AN1]
MLFIETSTFTKLLPNYLTDEEYRGLRTYLLQKPDAGDLIKGSGGVRKVRWAPAGSGKSGGIRAIYYWKKSDHEIWMLTLY
SKSERVSIPGHTLKQIAEAIKNG

Download         Length: 312 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10638.28 Da        Isoelectric Point: 10.0886

>AT263623 WP_012137897.1 NZ_CP110342:4086386-4086673 [Marinobacter sp. AN1]
MGDRNLGAEILDGINEIKQFKKGKLALRTHELSEPSPPKVIRLKLNMSQSAFAGLMGVSVRTLQDWEQGRREPQGPAVAL
LRIAEQHPEVFNQLH

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References