Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1756792..1757382 | Replicon | chromosome |
| Accession | NZ_CP110342 | ||
| Organism | Marinobacter sp. AN1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | LJ360_RS08040 | Protein ID | WP_264995781.1 |
| Coordinates | 1757104..1757382 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LJ360_RS08035 | Protein ID | WP_264995780.1 |
| Coordinates | 1756792..1757091 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LJ360_RS08010 (LJ360_08010) | 1751930..1752208 | - | 279 | Protein_1583 | flagellin | - |
| LJ360_RS08015 (LJ360_08015) | 1753271..1753741 | - | 471 | Protein_1584 | flagellin | - |
| LJ360_RS08020 (LJ360_08020) | 1754095..1755561 | - | 1467 | WP_264995777.1 | aldehyde dehydrogenase family protein | - |
| LJ360_RS08025 (LJ360_08025) | 1755754..1756197 | - | 444 | WP_264995778.1 | hypothetical protein | - |
| LJ360_RS08030 (LJ360_08030) | 1756274..1756594 | - | 321 | WP_264995779.1 | hypothetical protein | - |
| LJ360_RS08035 (LJ360_08035) | 1756792..1757091 | - | 300 | WP_264995780.1 | HigA family addiction module antitoxin | Antitoxin |
| LJ360_RS08040 (LJ360_08040) | 1757104..1757382 | - | 279 | WP_264995781.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LJ360_RS08045 (LJ360_08045) | 1757535..1758506 | + | 972 | WP_264995782.1 | transposase | - |
| LJ360_RS08050 (LJ360_08050) | 1758929..1759228 | - | 300 | WP_264995783.1 | type II toxin-antitoxin system VapC family toxin | - |
| LJ360_RS08055 (LJ360_08055) | 1759230..1759454 | - | 225 | WP_264995784.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| LJ360_RS08060 (LJ360_08060) | 1759991..1760773 | - | 783 | WP_264995785.1 | enoyl-CoA hydratase | - |
| LJ360_RS08065 (LJ360_08065) | 1761017..1761492 | + | 476 | Protein_1594 | flagellin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10676.11 Da Isoelectric Point: 8.5405
>T263621 WP_264995781.1 NZ_CP110342:c1757382-1757104 [Marinobacter sp. AN1]
MIRSFRCKETQGLFETGNTRRFSAIKNVAERKLILLQAAETLVDLKSPTGNRLEALKGDRTGQHSIRINQQWRVCFRWTD
DGPEDVEIVDYH
MIRSFRCKETQGLFETGNTRRFSAIKNVAERKLILLQAAETLVDLKSPTGNRLEALKGDRTGQHSIRINQQWRVCFRWTD
DGPEDVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|