Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 2162492..2163096 | Replicon | chromosome |
| Accession | NZ_CP110301 | ||
| Organism | Xanthomonas citri pv. fuscans strain CFBP 6533 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OM953_RS09545 | Protein ID | WP_099802820.1 |
| Coordinates | 2162492..2162806 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OM953_RS09550 | Protein ID | WP_099802819.1 |
| Coordinates | 2162806..2163096 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM953_RS09480 (OM953_09480) | 2157536..2157844 | - | 309 | WP_145958289.1 | helix-turn-helix domain-containing protein | - |
| OM953_RS09485 (OM953_09485) | 2157962..2158216 | - | 255 | WP_145958288.1 | hypothetical protein | - |
| OM953_RS09490 (OM953_09490) | 2158213..2158539 | - | 327 | WP_145958287.1 | hypothetical protein | - |
| OM953_RS09495 (OM953_09495) | 2158536..2158817 | - | 282 | WP_099801972.1 | hypothetical protein | - |
| OM953_RS09500 (OM953_09500) | 2159053..2159412 | - | 360 | WP_099863717.1 | helix-turn-helix domain-containing protein | - |
| OM953_RS09505 (OM953_09505) | 2159544..2159891 | - | 348 | WP_099801970.1 | hypothetical protein | - |
| OM953_RS09510 (OM953_09510) | 2159884..2160150 | - | 267 | WP_099801969.1 | hypothetical protein | - |
| OM953_RS09515 (OM953_09515) | 2160147..2160326 | - | 180 | WP_099801968.1 | hypothetical protein | - |
| OM953_RS09520 (OM953_09520) | 2160323..2160526 | - | 204 | WP_099801967.1 | hypothetical protein | - |
| OM953_RS09525 (OM953_09525) | 2160523..2160864 | - | 342 | WP_099801966.1 | hypothetical protein | - |
| OM953_RS09530 (OM953_09530) | 2160948..2161145 | - | 198 | WP_099801965.1 | hypothetical protein | - |
| OM953_RS09535 (OM953_09535) | 2161142..2161333 | - | 192 | WP_193588907.1 | helix-turn-helix domain-containing protein | - |
| OM953_RS09540 (OM953_09540) | 2161410..2162039 | + | 630 | WP_145958286.1 | hypothetical protein | - |
| OM953_RS09545 (OM953_09545) | 2162492..2162806 | + | 315 | WP_099802820.1 | hypothetical protein | Toxin |
| OM953_RS09550 (OM953_09550) | 2162806..2163096 | + | 291 | WP_099802819.1 | NadS family protein | Antitoxin |
| OM953_RS09555 (OM953_09555) | 2163088..2164317 | - | 1230 | WP_158526043.1 | site-specific integrase | - |
| OM953_RS09560 (OM953_09560) | 2165183..2165424 | + | 242 | Protein_1865 | hypothetical protein | - |
| OM953_RS09565 (OM953_09565) | 2165461..2167134 | + | 1674 | WP_089095178.1 | type IV secretory system conjugative DNA transfer family protein | - |
| OM953_RS09570 (OM953_09570) | 2167468..2167878 | + | 411 | WP_005914237.1 | TcpQ domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2143348..2180969 | 37621 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11650.49 Da Isoelectric Point: 9.3988
>T263594 WP_099802820.1 NZ_CP110301:2162492-2162806 [Xanthomonas citri pv. fuscans]
MIFVETPIFTASVTELLTDEQYGAFQSFLIAEPRAGDVIEQTGGLRKVRWSVAGKGKRGGVRVIYYFVDEADQIRLLLIY
KKGVQDDLTPSQKKVLKAIKDGWA
MIFVETPIFTASVTELLTDEQYGAFQSFLIAEPRAGDVIEQTGGLRKVRWSVAGKGKRGGVRVIYYFVDEADQIRLLLIY
KKGVQDDLTPSQKKVLKAIKDGWA
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|