Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HTH(antitoxin)
Location 2162492..2163096 Replicon chromosome
Accession NZ_CP110301
Organism Xanthomonas citri pv. fuscans strain CFBP 6533

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag OM953_RS09545 Protein ID WP_099802820.1
Coordinates 2162492..2162806 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OM953_RS09550 Protein ID WP_099802819.1
Coordinates 2162806..2163096 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM953_RS09480 (OM953_09480) 2157536..2157844 - 309 WP_145958289.1 helix-turn-helix domain-containing protein -
OM953_RS09485 (OM953_09485) 2157962..2158216 - 255 WP_145958288.1 hypothetical protein -
OM953_RS09490 (OM953_09490) 2158213..2158539 - 327 WP_145958287.1 hypothetical protein -
OM953_RS09495 (OM953_09495) 2158536..2158817 - 282 WP_099801972.1 hypothetical protein -
OM953_RS09500 (OM953_09500) 2159053..2159412 - 360 WP_099863717.1 helix-turn-helix domain-containing protein -
OM953_RS09505 (OM953_09505) 2159544..2159891 - 348 WP_099801970.1 hypothetical protein -
OM953_RS09510 (OM953_09510) 2159884..2160150 - 267 WP_099801969.1 hypothetical protein -
OM953_RS09515 (OM953_09515) 2160147..2160326 - 180 WP_099801968.1 hypothetical protein -
OM953_RS09520 (OM953_09520) 2160323..2160526 - 204 WP_099801967.1 hypothetical protein -
OM953_RS09525 (OM953_09525) 2160523..2160864 - 342 WP_099801966.1 hypothetical protein -
OM953_RS09530 (OM953_09530) 2160948..2161145 - 198 WP_099801965.1 hypothetical protein -
OM953_RS09535 (OM953_09535) 2161142..2161333 - 192 WP_193588907.1 helix-turn-helix domain-containing protein -
OM953_RS09540 (OM953_09540) 2161410..2162039 + 630 WP_145958286.1 hypothetical protein -
OM953_RS09545 (OM953_09545) 2162492..2162806 + 315 WP_099802820.1 hypothetical protein Toxin
OM953_RS09550 (OM953_09550) 2162806..2163096 + 291 WP_099802819.1 NadS family protein Antitoxin
OM953_RS09555 (OM953_09555) 2163088..2164317 - 1230 WP_158526043.1 site-specific integrase -
OM953_RS09560 (OM953_09560) 2165183..2165424 + 242 Protein_1865 hypothetical protein -
OM953_RS09565 (OM953_09565) 2165461..2167134 + 1674 WP_089095178.1 type IV secretory system conjugative DNA transfer family protein -
OM953_RS09570 (OM953_09570) 2167468..2167878 + 411 WP_005914237.1 TcpQ domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2143348..2180969 37621


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(36-87)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11650.49 Da        Isoelectric Point: 9.3988

>T263594 WP_099802820.1 NZ_CP110301:2162492-2162806 [Xanthomonas citri pv. fuscans]
MIFVETPIFTASVTELLTDEQYGAFQSFLIAEPRAGDVIEQTGGLRKVRWSVAGKGKRGGVRVIYYFVDEADQIRLLLIY
KKGVQDDLTPSQKKVLKAIKDGWA

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10638.24 Da        Isoelectric Point: 10.7495

>AT263594 WP_099802819.1 NZ_CP110301:2162806-2163096 [Xanthomonas citri pv. fuscans]
MDKNLFAQLAESMEQMGEITRGERAPSREIHIDAVRVKEVRAATGLSQAKFAQVIDVQLGTLRNWEQGRRNPTGPARALL
RAIKKDPKSVLEALSA

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References