Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 1821679..1822283 | Replicon | chromosome |
| Accession | NZ_CP110298 | ||
| Organism | Xanthomonas citri pv. fuscans strain BRM48906 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OM948_RS07640 | Protein ID | WP_099802820.1 |
| Coordinates | 1821679..1821993 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OM948_RS07645 | Protein ID | WP_099802819.1 |
| Coordinates | 1821993..1822283 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM948_RS07575 (OM948_07575) | 1816723..1817031 | - | 309 | WP_145958289.1 | helix-turn-helix domain-containing protein | - |
| OM948_RS07580 (OM948_07580) | 1817149..1817379 | - | 231 | WP_145958381.1 | hypothetical protein | - |
| OM948_RS07585 (OM948_07585) | 1817400..1817726 | - | 327 | WP_145958287.1 | hypothetical protein | - |
| OM948_RS07590 (OM948_07590) | 1817723..1818004 | - | 282 | WP_099801972.1 | hypothetical protein | - |
| OM948_RS07595 (OM948_07595) | 1818240..1818599 | - | 360 | WP_099863717.1 | helix-turn-helix domain-containing protein | - |
| OM948_RS07600 (OM948_07600) | 1818731..1819078 | - | 348 | WP_099801970.1 | hypothetical protein | - |
| OM948_RS07605 (OM948_07605) | 1819071..1819337 | - | 267 | WP_099801969.1 | hypothetical protein | - |
| OM948_RS07610 (OM948_07610) | 1819334..1819513 | - | 180 | WP_099801968.1 | hypothetical protein | - |
| OM948_RS07615 (OM948_07615) | 1819510..1819713 | - | 204 | WP_099801967.1 | hypothetical protein | - |
| OM948_RS07620 (OM948_07620) | 1819710..1820051 | - | 342 | WP_099801966.1 | hypothetical protein | - |
| OM948_RS07625 (OM948_07625) | 1820135..1820332 | - | 198 | WP_099801965.1 | hypothetical protein | - |
| OM948_RS07630 (OM948_07630) | 1820329..1820520 | - | 192 | WP_193588907.1 | helix-turn-helix domain-containing protein | - |
| OM948_RS07635 (OM948_07635) | 1820597..1821226 | + | 630 | WP_145958286.1 | hypothetical protein | - |
| OM948_RS07640 (OM948_07640) | 1821679..1821993 | + | 315 | WP_099802820.1 | hypothetical protein | Toxin |
| OM948_RS07645 (OM948_07645) | 1821993..1822283 | + | 291 | WP_099802819.1 | NadS family protein | Antitoxin |
| OM948_RS07650 (OM948_07650) | 1822275..1823504 | - | 1230 | WP_158526043.1 | site-specific integrase | - |
| OM948_RS07655 (OM948_07655) | 1824370..1824612 | + | 243 | WP_022559483.1 | hypothetical protein | - |
| OM948_RS07660 (OM948_07660) | 1824649..1826322 | + | 1674 | WP_089095178.1 | type IV secretory system conjugative DNA transfer family protein | - |
| OM948_RS07665 (OM948_07665) | 1826656..1827066 | + | 411 | WP_005914237.1 | TcpQ domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1801197..1840158 | 38961 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11650.49 Da Isoelectric Point: 9.3988
>T263590 WP_099802820.1 NZ_CP110298:1821679-1821993 [Xanthomonas citri pv. fuscans]
MIFVETPIFTASVTELLTDEQYGAFQSFLIAEPRAGDVIEQTGGLRKVRWSVAGKGKRGGVRVIYYFVDEADQIRLLLIY
KKGVQDDLTPSQKKVLKAIKDGWA
MIFVETPIFTASVTELLTDEQYGAFQSFLIAEPRAGDVIEQTGGLRKVRWSVAGKGKRGGVRVIYYFVDEADQIRLLLIY
KKGVQDDLTPSQKKVLKAIKDGWA
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|