Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HTH(antitoxin)
Location 1821679..1822283 Replicon chromosome
Accession NZ_CP110298
Organism Xanthomonas citri pv. fuscans strain BRM48906

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag OM948_RS07640 Protein ID WP_099802820.1
Coordinates 1821679..1821993 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OM948_RS07645 Protein ID WP_099802819.1
Coordinates 1821993..1822283 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM948_RS07575 (OM948_07575) 1816723..1817031 - 309 WP_145958289.1 helix-turn-helix domain-containing protein -
OM948_RS07580 (OM948_07580) 1817149..1817379 - 231 WP_145958381.1 hypothetical protein -
OM948_RS07585 (OM948_07585) 1817400..1817726 - 327 WP_145958287.1 hypothetical protein -
OM948_RS07590 (OM948_07590) 1817723..1818004 - 282 WP_099801972.1 hypothetical protein -
OM948_RS07595 (OM948_07595) 1818240..1818599 - 360 WP_099863717.1 helix-turn-helix domain-containing protein -
OM948_RS07600 (OM948_07600) 1818731..1819078 - 348 WP_099801970.1 hypothetical protein -
OM948_RS07605 (OM948_07605) 1819071..1819337 - 267 WP_099801969.1 hypothetical protein -
OM948_RS07610 (OM948_07610) 1819334..1819513 - 180 WP_099801968.1 hypothetical protein -
OM948_RS07615 (OM948_07615) 1819510..1819713 - 204 WP_099801967.1 hypothetical protein -
OM948_RS07620 (OM948_07620) 1819710..1820051 - 342 WP_099801966.1 hypothetical protein -
OM948_RS07625 (OM948_07625) 1820135..1820332 - 198 WP_099801965.1 hypothetical protein -
OM948_RS07630 (OM948_07630) 1820329..1820520 - 192 WP_193588907.1 helix-turn-helix domain-containing protein -
OM948_RS07635 (OM948_07635) 1820597..1821226 + 630 WP_145958286.1 hypothetical protein -
OM948_RS07640 (OM948_07640) 1821679..1821993 + 315 WP_099802820.1 hypothetical protein Toxin
OM948_RS07645 (OM948_07645) 1821993..1822283 + 291 WP_099802819.1 NadS family protein Antitoxin
OM948_RS07650 (OM948_07650) 1822275..1823504 - 1230 WP_158526043.1 site-specific integrase -
OM948_RS07655 (OM948_07655) 1824370..1824612 + 243 WP_022559483.1 hypothetical protein -
OM948_RS07660 (OM948_07660) 1824649..1826322 + 1674 WP_089095178.1 type IV secretory system conjugative DNA transfer family protein -
OM948_RS07665 (OM948_07665) 1826656..1827066 + 411 WP_005914237.1 TcpQ domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1801197..1840158 38961


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(36-87)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11650.49 Da        Isoelectric Point: 9.3988

>T263590 WP_099802820.1 NZ_CP110298:1821679-1821993 [Xanthomonas citri pv. fuscans]
MIFVETPIFTASVTELLTDEQYGAFQSFLIAEPRAGDVIEQTGGLRKVRWSVAGKGKRGGVRVIYYFVDEADQIRLLLIY
KKGVQDDLTPSQKKVLKAIKDGWA

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10638.24 Da        Isoelectric Point: 10.7495

>AT263590 WP_099802819.1 NZ_CP110298:1821993-1822283 [Xanthomonas citri pv. fuscans]
MDKNLFAQLAESMEQMGEITRGERAPSREIHIDAVRVKEVRAATGLSQAKFAQVIDVQLGTLRNWEQGRRNPTGPARALL
RAIKKDPKSVLEALSA

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References