Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HTH(antitoxin)
Location 3079684..3080288 Replicon chromosome
Accession NZ_CP110296
Organism Xanthomonas citri pv. fuscans strain LNPV 30.30

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag OM946_RS13535 Protein ID WP_099802820.1
Coordinates 3079974..3080288 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OM946_RS13530 Protein ID WP_099802819.1
Coordinates 3079684..3079974 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM946_RS13510 (OM946_13510) 3074901..3075311 - 411 WP_005914237.1 TcpQ domain-containing protein -
OM946_RS13515 (OM946_13515) 3075645..3077318 - 1674 WP_089095178.1 type IV secretory system conjugative DNA transfer family protein -
OM946_RS13520 (OM946_13520) 3077355..3077597 - 243 WP_022559483.1 hypothetical protein -
OM946_RS13525 (OM946_13525) 3078463..3079692 + 1230 WP_158526043.1 site-specific integrase -
OM946_RS13530 (OM946_13530) 3079684..3079974 - 291 WP_099802819.1 NadS family protein Antitoxin
OM946_RS13535 (OM946_13535) 3079974..3080288 - 315 WP_099802820.1 hypothetical protein Toxin
OM946_RS13540 (OM946_13540) 3080741..3081370 - 630 WP_145958286.1 hypothetical protein -
OM946_RS13545 (OM946_13545) 3081447..3081638 + 192 WP_193588907.1 helix-turn-helix domain-containing protein -
OM946_RS13550 (OM946_13550) 3081635..3081832 + 198 WP_099801965.1 hypothetical protein -
OM946_RS13555 (OM946_13555) 3081916..3082257 + 342 WP_099801966.1 hypothetical protein -
OM946_RS13560 (OM946_13560) 3082254..3082457 + 204 WP_099801967.1 hypothetical protein -
OM946_RS13565 (OM946_13565) 3082454..3082633 + 180 WP_099801968.1 hypothetical protein -
OM946_RS13570 (OM946_13570) 3082630..3082896 + 267 WP_099801969.1 hypothetical protein -
OM946_RS13575 (OM946_13575) 3082889..3083236 + 348 WP_099801970.1 hypothetical protein -
OM946_RS13580 (OM946_13580) 3083368..3083727 + 360 WP_099863717.1 helix-turn-helix domain-containing protein -
OM946_RS13585 (OM946_13585) 3083963..3084244 + 282 WP_099801972.1 hypothetical protein -
OM946_RS13590 (OM946_13590) 3084241..3084567 + 327 WP_145958287.1 hypothetical protein -
OM946_RS13595 (OM946_13595) 3084564..3084818 + 255 WP_145958288.1 hypothetical protein -
OM946_RS13600 (OM946_13600) 3084936..3085244 + 309 WP_145958289.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3063217..3099918 36701


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(36-87)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11650.49 Da        Isoelectric Point: 9.3988

>T263586 WP_099802820.1 NZ_CP110296:c3080288-3079974 [Xanthomonas citri pv. fuscans]
MIFVETPIFTASVTELLTDEQYGAFQSFLIAEPRAGDVIEQTGGLRKVRWSVAGKGKRGGVRVIYYFVDEADQIRLLLIY
KKGVQDDLTPSQKKVLKAIKDGWA

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10638.24 Da        Isoelectric Point: 10.7495

>AT263586 WP_099802819.1 NZ_CP110296:c3079974-3079684 [Xanthomonas citri pv. fuscans]
MDKNLFAQLAESMEQMGEITRGERAPSREIHIDAVRVKEVRAATGLSQAKFAQVIDVQLGTLRNWEQGRRNPTGPARALL
RAIKKDPKSVLEALSA

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References