Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 3079684..3080288 | Replicon | chromosome |
| Accession | NZ_CP110296 | ||
| Organism | Xanthomonas citri pv. fuscans strain LNPV 30.30 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OM946_RS13535 | Protein ID | WP_099802820.1 |
| Coordinates | 3079974..3080288 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OM946_RS13530 | Protein ID | WP_099802819.1 |
| Coordinates | 3079684..3079974 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM946_RS13510 (OM946_13510) | 3074901..3075311 | - | 411 | WP_005914237.1 | TcpQ domain-containing protein | - |
| OM946_RS13515 (OM946_13515) | 3075645..3077318 | - | 1674 | WP_089095178.1 | type IV secretory system conjugative DNA transfer family protein | - |
| OM946_RS13520 (OM946_13520) | 3077355..3077597 | - | 243 | WP_022559483.1 | hypothetical protein | - |
| OM946_RS13525 (OM946_13525) | 3078463..3079692 | + | 1230 | WP_158526043.1 | site-specific integrase | - |
| OM946_RS13530 (OM946_13530) | 3079684..3079974 | - | 291 | WP_099802819.1 | NadS family protein | Antitoxin |
| OM946_RS13535 (OM946_13535) | 3079974..3080288 | - | 315 | WP_099802820.1 | hypothetical protein | Toxin |
| OM946_RS13540 (OM946_13540) | 3080741..3081370 | - | 630 | WP_145958286.1 | hypothetical protein | - |
| OM946_RS13545 (OM946_13545) | 3081447..3081638 | + | 192 | WP_193588907.1 | helix-turn-helix domain-containing protein | - |
| OM946_RS13550 (OM946_13550) | 3081635..3081832 | + | 198 | WP_099801965.1 | hypothetical protein | - |
| OM946_RS13555 (OM946_13555) | 3081916..3082257 | + | 342 | WP_099801966.1 | hypothetical protein | - |
| OM946_RS13560 (OM946_13560) | 3082254..3082457 | + | 204 | WP_099801967.1 | hypothetical protein | - |
| OM946_RS13565 (OM946_13565) | 3082454..3082633 | + | 180 | WP_099801968.1 | hypothetical protein | - |
| OM946_RS13570 (OM946_13570) | 3082630..3082896 | + | 267 | WP_099801969.1 | hypothetical protein | - |
| OM946_RS13575 (OM946_13575) | 3082889..3083236 | + | 348 | WP_099801970.1 | hypothetical protein | - |
| OM946_RS13580 (OM946_13580) | 3083368..3083727 | + | 360 | WP_099863717.1 | helix-turn-helix domain-containing protein | - |
| OM946_RS13585 (OM946_13585) | 3083963..3084244 | + | 282 | WP_099801972.1 | hypothetical protein | - |
| OM946_RS13590 (OM946_13590) | 3084241..3084567 | + | 327 | WP_145958287.1 | hypothetical protein | - |
| OM946_RS13595 (OM946_13595) | 3084564..3084818 | + | 255 | WP_145958288.1 | hypothetical protein | - |
| OM946_RS13600 (OM946_13600) | 3084936..3085244 | + | 309 | WP_145958289.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3063217..3099918 | 36701 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11650.49 Da Isoelectric Point: 9.3988
>T263586 WP_099802820.1 NZ_CP110296:c3080288-3079974 [Xanthomonas citri pv. fuscans]
MIFVETPIFTASVTELLTDEQYGAFQSFLIAEPRAGDVIEQTGGLRKVRWSVAGKGKRGGVRVIYYFVDEADQIRLLLIY
KKGVQDDLTPSQKKVLKAIKDGWA
MIFVETPIFTASVTELLTDEQYGAFQSFLIAEPRAGDVIEQTGGLRKVRWSVAGKGKRGGVRVIYYFVDEADQIRLLLIY
KKGVQDDLTPSQKKVLKAIKDGWA
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|