Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2730375..2730711 | Replicon | chromosome |
| Accession | NZ_CP110289 | ||
| Organism | Enterococcus faecalis strain AKSZ-208 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | MZO28_RS13545 | Protein ID | WP_073437820.1 |
| Coordinates | 2730375..2730518 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2730662..2730711 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MZO28_RS13525 | 2726467..2727105 | - | 639 | WP_073438309.1 | lytic polysaccharide monooxygenase | - |
| MZO28_RS13530 | 2727791..2729407 | + | 1617 | WP_002406969.1 | phosphatase PAP2/LCP family protein | - |
| MZO28_RS13535 | 2729736..2729885 | + | 150 | WP_002411240.1 | type I toxin-antitoxin system toxin PepG1 | - |
| MZO28_RS13540 | 2730004..2730144 | + | 141 | WP_073340360.1 | putative holin-like toxin | - |
| MZO28_RS13545 | 2730375..2730518 | + | 144 | WP_073437820.1 | putative holin-like toxin | Toxin |
| - | 2730662..2730711 | + | 50 | - | - | Antitoxin |
| MZO28_RS13550 | 2730713..2735404 | - | 4692 | WP_085345106.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5274.27 Da Isoelectric Point: 8.6626
>T263581 WP_073437820.1 NZ_CP110289:2730375-2730518 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFEILEAVKENNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFEILEAVKENNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT263581 NZ_CP110289:2730662-2730711 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|