Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2729736..2730002 | Replicon | chromosome |
Accession | NZ_CP110289 | ||
Organism | Enterococcus faecalis strain AKSZ-208 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | MZO28_RS13535 | Protein ID | WP_002411240.1 |
Coordinates | 2729736..2729885 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2729818..2730002 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MZO28_RS13515 | 2724857..2725072 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
MZO28_RS13520 | 2725211..2726203 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
MZO28_RS13525 | 2726467..2727105 | - | 639 | WP_073438309.1 | lytic polysaccharide monooxygenase | - |
MZO28_RS13530 | 2727791..2729407 | + | 1617 | WP_002406969.1 | phosphatase PAP2/LCP family protein | - |
MZO28_RS13535 | 2729736..2729885 | + | 150 | WP_002411240.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- | 2729818..2730002 | - | 185 | - | - | Antitoxin |
MZO28_RS13540 | 2730004..2730144 | + | 141 | WP_073340360.1 | putative holin-like toxin | - |
MZO28_RS13545 | 2730375..2730518 | + | 144 | WP_073437820.1 | putative holin-like toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5738.05 Da Isoelectric Point: 11.3858
>T263571 WP_002411240.1 NZ_CP110289:2729736-2729885 [Enterococcus faecalis]
MRMHVFPKFRERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MRMHVFPKFRERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 150 bp
Antitoxin
Download Length: 185 bp
>AT263571 NZ_CP110289:c2730002-2729818 [Enterococcus faecalis]
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCA
ATCAAAGCAATGGTAAACATACCAA
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCA
ATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|