Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | yonT-as-bsrE/- |
| Location | 2180191..2180667 | Replicon | chromosome |
| Accession | NZ_CP110268 | ||
| Organism | Bacillus siamensis strain YB-1631 | ||
Toxin (Protein)
| Gene name | yonT | Uniprot ID | - |
| Locus tag | OM992_RS11285 | Protein ID | WP_264818719.1 |
| Coordinates | 2180191..2180406 (-) | Length | 72 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrE | ||
| Locus tag | - | ||
| Coordinates | 2180581..2180667 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM992_RS11245 (2175362) | 2175362..2175514 | - | 153 | WP_264818710.1 | hypothetical protein | - |
| OM992_RS11250 (2175864) | 2175864..2176286 | - | 423 | WP_264818711.1 | hypothetical protein | - |
| OM992_RS11255 (2176341) | 2176341..2176595 | - | 255 | WP_264818712.1 | hypothetical protein | - |
| OM992_RS11260 (2176655) | 2176655..2177419 | - | 765 | WP_264818713.1 | hypothetical protein | - |
| OM992_RS11265 (2177544) | 2177544..2177762 | - | 219 | WP_264818714.1 | hypothetical protein | - |
| OM992_RS11270 (2177759) | 2177759..2178214 | - | 456 | WP_264818715.1 | hypothetical protein | - |
| OM992_RS11275 (2178518) | 2178518..2179750 | - | 1233 | WP_264818717.1 | hypothetical protein | - |
| OM992_RS11280 (2179943) | 2179943..2180158 | - | 216 | WP_264818718.1 | hypothetical protein | - |
| OM992_RS11285 (2180191) | 2180191..2180406 | - | 216 | WP_264818719.1 | hypothetical protein | Toxin |
| - (2180581) | 2180581..2180667 | + | 87 | NuclAT_0 | - | Antitoxin |
| - (2180581) | 2180581..2180667 | + | 87 | NuclAT_0 | - | Antitoxin |
| - (2180581) | 2180581..2180667 | + | 87 | NuclAT_0 | - | Antitoxin |
| - (2180581) | 2180581..2180667 | + | 87 | NuclAT_0 | - | Antitoxin |
| OM992_RS11290 (2181616) | 2181616..2182728 | - | 1113 | WP_264818720.1 | tubulin-like doman-containing protein | - |
| OM992_RS11295 (2182728) | 2182728..2183012 | - | 285 | WP_264818721.1 | hypothetical protein | - |
| OM992_RS11300 (2183190) | 2183190..2183426 | + | 237 | WP_038458718.1 | helix-turn-helix domain-containing protein | - |
| OM992_RS11305 (2183546) | 2183546..2183725 | + | 180 | WP_038458720.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2094074..2240804 | 146730 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 72 a.a. Molecular weight: 8494.47 Da Isoelectric Point: 10.3923
>T263545 WP_264818719.1 NZ_CP110268:c2180406-2180191 [Bacillus siamensis]
MDKHIVNMKRFSLWFTNITFIVLFLLFLFIKDYFSSGIQSLITAIFIVTCIIVILLWIIYFALRKKINKCN
MDKHIVNMKRFSLWFTNITFIVLFLLFLFIKDYFSSGIQSLITAIFIVTCIIVILLWIIYFALRKKINKCN
Download Length: 216 bp
Antitoxin
Download Length: 87 bp
>AT263545 NZ_CP110268:2180581-2180667 [Bacillus siamensis]
TAAAACCGTGATAGGAATAAGGAAAGCAATTGTTATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTATAACTC
TATTATA
TAAAACCGTGATAGGAATAAGGAAAGCAATTGTTATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTATAACTC
TATTATA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|