Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 324438..325024 Replicon chromosome
Accession NZ_CP110265
Organism Klebsiella pneumoniae strain YZ22CS070

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag OMD39_RS01505 Protein ID WP_002920800.1
Coordinates 324656..325024 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A483YZZ9
Locus tag OMD39_RS01500 Protein ID WP_019725146.1
Coordinates 324438..324659 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMD39_RS01480 (320595) 320595..321521 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OMD39_RS01485 (321518) 321518..322795 + 1278 WP_004188292.1 branched chain amino acid ABC transporter permease LivM -
OMD39_RS01490 (322792) 322792..323559 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OMD39_RS01495 (323561) 323561..324274 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OMD39_RS01500 (324438) 324438..324659 + 222 WP_019725146.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OMD39_RS01505 (324656) 324656..325024 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OMD39_RS01510 (325297) 325297..326613 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OMD39_RS01515 (326720) 326720..327607 + 888 WP_014906831.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OMD39_RS01520 (327604) 327604..328449 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OMD39_RS01525 (328451) 328451..329521 + 1071 WP_004188298.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 321518..330258 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T263525 WP_002920800.1 NZ_CP110265:324656-325024 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT263525 WP_019725146.1 NZ_CP110265:324438-324659 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A483YZZ9

References