Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 41634..41898 Replicon plasmid pKBSW16i-B
Accession NZ_CP110262
Organism Escherichia albertii strain KBSW16i

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag N6N74_RS24145 Protein ID WP_001331364.1
Coordinates 41746..41898 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 41634..41691 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6N74_RS24130 (36873) 36873..39164 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
N6N74_RS24135 (39157) 39157..40227 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
N6N74_RS24140 (40246) 40246..41454 - 1209 WP_016245570.1 IncI1-type conjugal transfer protein TrbA -
- (41634) 41634..41691 - 58 NuclAT_0 - Antitoxin
- (41634) 41634..41691 - 58 NuclAT_0 - Antitoxin
- (41634) 41634..41691 - 58 NuclAT_0 - Antitoxin
- (41634) 41634..41691 - 58 NuclAT_0 - Antitoxin
N6N74_RS24145 (41746) 41746..41898 + 153 WP_001331364.1 Hok/Gef family protein Toxin
N6N74_RS24150 (41970) 41970..42221 - 252 WP_001291964.1 hypothetical protein -
N6N74_RS24155 (42583) 42583..42815 + 233 Protein_51 hypothetical protein -
N6N74_RS24160 (42880) 42880..43017 - 138 WP_262930367.1 hypothetical protein -
N6N74_RS24165 (43062) 43062..44288 - 1227 WP_024186316.1 RNA-guided endonuclease TnpB family protein -
N6N74_RS24170 (44347) 44347..44751 + 405 WP_001175009.1 IS200/IS605 family transposase -
N6N74_RS24175 (45083) 45083..45292 - 210 WP_001140543.1 hemolysin expression modulator Hha -
N6N74_RS24180 (45390) 45390..46052 - 663 WP_000644794.1 plasmid IncI1-type surface exclusion protein ExcA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..89449 89449


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T263518 WP_001331364.1 NZ_CP110262:41746-41898 [Escherichia albertii]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT263518 NZ_CP110262:c41691-41634 [Escherichia albertii]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References